powered by:
Protein Alignment HmgZ and hmg-6
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_493451.2 |
Gene: | hmg-6 / 185946 |
WormBaseID: | WBGene00009827 |
Length: | 128 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
| Similarity: | 33/69 - (47%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 RPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLKDKTEWEQKAIKMKEEYNK------ 66
|..|||.|:..|.:...|:..|.:....|:::....|..| ||.|:||.|.:.|.|:
Worm 51 RSTSAYALFFRERQSLEKRAAPYATFGQISQKIARQWDSL---TEEEKKAYKQRCEKNRKTSIAN 112
Fly 67 AVKE 70
||:|
Worm 113 AVEE 116
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5648 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.