DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HmgZ and hmg-4

DIOPT Version :9

Sequence 1:	NP_001286694.1	Gene:	HmgZ / 37480	FlyBaseID:	FBgn0010228	Length:	111	Species:	Drosophila melanogaster
Sequence 2:	NP_498633.1	Gene:	hmg-4 / 176052	WormBaseID:	WBGene00001974	Length:	697	Species:	Caenorhabditis elegans

Alignment Length:	141	Identity:	48/141 - (34%)
Similarity:	63/141 - (44%)	Gaps:	37/141 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNKAV 68
            |||..||||.|...:|.::|:|  |..|.|:||:||..|:.:.  ||.:||:||.:.|..|.|.:
Worm   556 PKRATSAYMQWFLASRNELKED--GDSVADVAKKGGAKWKTMSSDDKKKWEEKAEEDKSRYEKEM 618

  Fly    69 KEYEANGGTDSGAPKKRKKAAAK-------------------------PAKKAKKKESSEEEEE- 107
            |||..||...|.:.....|.:.|                         |.||.||....||.||
Worm   619 KEYRKNGPPSSSSKPSSSKTSKKSSGPSSSKAISKEYISDSDDSDDEEPKKKEKKAAPKEESEES 683

  Fly   108 -------DESE 111
                   |||:
Worm   684 NNGSDGSDESD 694

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HmgZ	NP_001286694.1	HMG_box	6..71	CDD:395407	29/66 (44%)
hmg-4	NP_498633.1	SSrecog	75..285	CDD:281523
		PH2_SSRP1-like	332..429	CDD:270051
		HMGB-UBF_HMG-box	556..619	CDD:238686	28/64 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160160106
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.840