DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and hmg-3

DIOPT Version :10

Sequence 1:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_491688.1 Gene:hmg-3 / 172250 WormBaseID:WBGene00001973 Length:689 Species:Caenorhabditis elegans


Alignment Length:113 Identity:40/113 - (35%)
Similarity:62/113 - (54%) Gaps:7/113 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNK 66
            :.|||..:||::|.|..|..:|:|  |..:.|:||:.|..|:.:.  ||.||..||.:.|..|..
 Worm   559 NEPKRATTAYIIWFNANRNSMKED--GDTLGDVAKKAGAKWKSMSADDKKEWNDKAAQDKARYEA 621

  Fly    67 AVKEYEANGG--TDSGAPKKRKKAAAKPAKKAKKKES-SEEEEEDESE 111
            .:|||:.|||  ..:..|..:|.:...|.|:.|.||. |:.::.|:.|
 Worm   622 EMKEYKKNGGGVEKASGPSTKKSSDQSPGKQFKSKEHISDTDDSDDDE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_726106.1 HMG-box_SSRP1-like 8..72 CDD:438810 24/65 (37%)
hmg-3NP_491688.1 POB3 20..497 CDD:227494
HMG-box_SSRP1-like 563..627 CDD:438810 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.