DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and pop-1

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_491053.4 Gene:pop-1 / 171849 WormBaseID:WBGene00004077 Length:438 Species:Caenorhabditis elegans


Alignment Length:112 Identity:25/112 - (22%)
Similarity:54/112 - (48%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRPKRPLSAYMLWLNETREQIKKD--NPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEY 64
            |..|:||:|:|.::.|.|:.:.::  |...:..::.|..|:.|..|  :::.::.:.|.|.||.:
 Worm   190 DHVKKPLNAFMWFMKENRKALLEEIGNNEKQSAELNKELGKRWHDLSKEEQAKYFEMAKKDKETH 254

  Fly    65 NKAVKEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111
            .:...|:.|           |:..|....|..|:::.|...|.::.:
 Worm   255 KERYPEWSA-----------RENYAVNKKKTKKRRDKSIPSENNDQK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 16/68 (24%)
pop-1NP_491053.4 SOX-TCF_HMG-box 191..264 CDD:238684 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.