DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HmgZ and AgaP_AGAP000005

DIOPT Version :9

Sequence 1:NP_001286694.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_311155.4 Gene:AgaP_AGAP000005 / 1272270 VectorBaseID:AGAP000005 Length:457 Species:Anopheles gambiae


Alignment Length:143 Identity:38/143 - (26%)
Similarity:62/143 - (43%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGL--KDKTEWEQKAIKMKEEYNKAV 68
            |||.|||:..:.::.|.::|..||...|.||||..|..|..:  :.|.::||.|.|.|:.|.:.:
Mosquito   311 PKRSLSAFFWFCHDERNKVKALNPEYGVGDIAKELGRKWSDMDAEIKQKYEQMAEKDKQRYEQEM 375

  Fly    69 KEYE-----ANGGTDSG--APKKRKKA----------------------------AAKPAKKAKK 98
            .||:     ..||...|  .|::.::|                            ||..|...::
Mosquito   376 TEYKLKCKNEQGGVTPGLNLPQQLQQAGLQHLPQHVQAAAQLQAQVVQAQQAAAVAAAAAAAVQQ 440

  Fly    99 KESSEEEEEDESE 111
            :...::|:||..|
Mosquito   441 QHDDDDEDEDGDE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmgZNP_001286694.1 HMG_box 6..71 CDD:395407 24/66 (36%)
AgaP_AGAP000005XP_311155.4 HMG-box 217..288 CDD:294061
HMGB-UBF_HMG-box 311..375 CDD:238686 24/63 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000133
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.