powered by:
Protein Alignment HmgZ and LOC108349258
DIOPT Version :9
| Sequence 1: | NP_001286694.1 |
Gene: | HmgZ / 37480 |
FlyBaseID: | FBgn0010228 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_017457896.2 |
Gene: | LOC108349258 / 108349258 |
RGDID: | 11417756 |
Length: | 168 |
Species: | Rattus norvegicus |
| Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
| Similarity: | 42/72 - (58%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 DRPKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWRGLK--DKTEWEQKAIKMKEEYNK 66
|.|::|.|:::|:..:..|:||:.:|...|..:||..|.:|.... ||..:|::|..::.:|
Rat 91 DAPRKPPSSFLLFSQDHFEEIKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKY-- 153
Fly 67 AVKEYEA 73
::|.||
Rat 154 -LEEREA 159
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1641977at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.