DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rae1 and Bub3

Sequence 1:NP_611597.1 Gene:Rae1 FlyBaseID:FBgn0034646 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001287587.1 Gene:Bub3 FlyBaseID:FBgn0025457 Length:326 Species:Drosophila melanogaster

Alignment Length:312 Identity:102/313 (33%)
Similarity:161/313 (51%) Gaps:22/313 (7%)


  Fly    10 RMNDFEVASPPDDSVSALEFSPSTVQKNFLVAGSWDSTVRCWEVEQNGATVPKSMKTMGGPVLDV 74
            |..:|::.:||:|.:||::|.|.:.|  ::.|.|||.|:|.::|..|..   :.......|:|| 
  Fly     2 RPPEFKLNNPPEDLISAVKFGPKSNQ--YMAASSWDGTLRFYDVPANQL---RQKFVQDAPLLD- 60

  Fly    75 CWSDDGSKVFVASCDKQVKLWDLASDQVMQVAAHDGPVKT---CHMVKGPTYTCLMTGSWDKTLK 136
            |...|...|...|.|.|::|:|:.:.....:.||:.|::.   ...|.|     ::|||||.|:|
  Fly    61 CAFMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVNG-----ILTGSWDNTVK 120

  Fly   137 FWDTRSPNPMMTINLPE-RCYCADVEYPMAVVGTANRGLIIYSLQNSPTEYKRQESPLKYQHRAI 200
            .||.|....:.|..... :.|...|.....||.|::|.::|:.|:...:...::||.||||.|.|
  Fly   121 LWDMREKRCVGTFEQNNGKVYSMSVIDEKIVVATSDRKVLIWDLRKMDSYIMKRESSLKYQTRCI 185

  Fly   201 SIFRDKKKEPTGCALGSIEGRVAIQYV--NPGNPKDNFTFKCHRTTGTSGYQDIYAVNDIAFHPV 263
            .:|.:|:    |..:.|||||||::|:  :|...:..|.|||||.. ....:.||.||.::||.|
  Fly   186 RLFPNKE----GYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNR-EQNIEQIYPVNALSFHNV 245

  Fly   264 HGTLVTVGSDGTFSFWDKDARTKLKSSETMDQSITKCGFNANGQIFAYAVGY 315
            :.|..|.||||..:.||...:.:|......|.||:...|:::|...|....|
  Fly   246 YQTFATGGSDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSY 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rae1NP_611597.1 WD40 <18..310 CDD:225201 98/298 (33%)
WD40 22..310 CDD:295369 96/294 (33%)
WD40 repeat 25..66 CDD:293791 13/41 (32%)
WD40 repeat 71..105 CDD:293791 10/34 (29%)
WD40 repeat 113..150 CDD:293791 13/40 (33%)
WD40 repeat 157..239 CDD:293791 29/84 (35%)
WD40 repeat 255..293 CDD:293791 14/38 (37%)
Bub3NP_001287587.1 WD40 <10..296 CDD:225201 99/302 (33%)
WD40 16..262 CDD:295369 88/262 (34%)
WD40 repeat 16..53 CDD:293791 13/42 (31%)
WD40 repeat 59..93 CDD:293791 10/35 (29%)
WD40 repeat 98..134 CDD:293791 13/41 (32%)
WD40 repeat 141..175 CDD:293791 8/34 (24%)
WD40 repeat 182..222 CDD:293791 16/44 (36%)
WD40 repeat 237..283 CDD:293791 17/46 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C7466641
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1048963at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10971
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.