DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mahj and Dcaf1

Sequence 1:NP_001246451.1 Gene:mahj FlyBaseID:FBgn0034641 Length:1544 Species:Drosophila melanogaster
Sequence 2:XP_006511816.1 Gene:Dcaf1 MGIID:2445220 Length:1516 Species:Mus musculus

Alignment Length:1543 Identity:590/1544 (38%)
Similarity:857/1544 (56%) Gaps:201/1544 (13%)


  Fly   109 TKKELTQIIDKWEQQQTQNGYDPVPTLRSLAEIFEREKDVYRRKDPDPLDSRHPYRADPSCQYGL 173
            :|.|||.::::||:.. .:|.|.||.|..::|:.|:|.:.||:.||||.|.|||.||||.|..|.
Mouse    20 SKAELTTLLEQWEKDH-GSGQDMVPILTRMSELIEKETEEYRKGDPDPFDDRHPGRADPECMLGH 83

  Fly   174 LLKLLFRKDTFMGKLLNDYLRENYFSRQNVSRSSLELNILACRLILEIMPGMETSAVFQTAEGDG 238
            ||::||:.|.||..|:|.|:.        .||.. .||..||||:|:||||:||:.|||  |.:|
Mouse    84 LLRILFKNDDFMNALVNAYVM--------TSREP-PLNTAACRLLLDIMPGLETAVVFQ--EKEG 137

  Fly   239 TINRIYSWAEDSIEPLQSYATGLLAEAMEVSDIAINFRDLNIRLVPKMIKRL------------- 290
            .:..::.||.::.:||::|:||||..|||..|||.|:||.|.:||..:::||             
Mouse   138 IVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLRELQLQEVALRQD 202

  Fly   291 -----------HMLLAISKSATS--------DVNTSMHNLSADSSTAGML-SWVACASNASAPQS 335
                       ..||.:.:.|..        ||.......|.|...:..| |....:|..::...
Mouse   203 SKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDVVDGEQESSRDMEISFRLDSSHKTSSRVNSATK 267

  Fly   336 PQHNGSGLGASSSQHGDASNM---------------SILFENSRDAFS-VSRYYKRMYIPLHPAT 384
            |:..|.... .|::|||..|.               .:..|.|..::| :|.:.......|:|.|
Mouse   268 PEEGGLKKN-KSAKHGDRENFRKAKQKLGFSSSDPDRVFVELSNSSWSEMSPWVIGTNYTLYPMT 331

  Fly   385 ADTSQMLIMRFLTSLGEYQEFLAMAFENNVMQLIFGYLENLDRRDTCLAYEVLKYLASLLCHKKF 449
            ....|.||:::||.||||||.|.:..:....:|:..|::.....|..|.:|.||:|||||.|.||
Mouse   332 PAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLLTFEALKHLASLLLHNKF 396

  Fly   450 ALEFISHGGLELLLKVPRPSLATTGVSIAIYYLAYCEDAMERICSMQRPLISELVRYALWILGRC 514
            |.||::|||::.||::||||:|.||||:.:|||:|.:|||||:|.....::|::|.|.||::...
Mouse   397 ATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYLSYNQDAMERVCMHPHNVLSDVVNYTLWLMECS 461

  Fly   515 HDSSKCHATMFFSLSFQFKVILDEFDAQDGLRKLYNVISVLKILDPSHNDSDNDSDFNEDVECAS 579
            |.|..||||||||:.|.|:.:|:.||..||||:|.|:||.|:||    |..|..:..::|...||
Mouse   462 HASGCCHATMFFSICFSFRAVLELFDRYDGLRRLVNLISTLEIL----NLEDQGALLSDDEIFAS 522

  Fly   580 RQMVRHVCVALKRYMEAHFFYKYNSF---LCQTNA---ASPAPSSAHYFNQNPTVAAKLTFDQLN 638
            ||..:|.|:||::|.|||...|....   |.:|..   ..|.|         |..|...|.:|:.
Mouse   523 RQTGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQP---------PYKACSYTHEQIV 578

  Fly   639 DQIRTLQEHTSIRAHWQPVDQLMKLGGITMLLRIIAFSYDW-VNSGRSETVRSALDVLSVCCIIP 702
            :.:..|.|:...:.:|:|.:..:||..:.:||::|:.:.:| ....|::|||.|||||::..::|
Mouse   579 EMMEFLIEYGPAQLYWEPAEVFLKLSCVQLLLQLISIACNWKTYYARNDTVRFALDVLAILTVVP 643

  Fly   703 RVYVVLCERLLMLDK----TTTSGFCSVLGAAAGE-ISSDAEVIKSALAVLCHCVCSPIIRKDSG 762
            ::.:.|.|.:.:||:    .:|.|...:||.|.|| ...|||:.||||.::.:|||.|    |:.
Mouse   644 KIQLQLAESVDVLDEAGSAVSTVGISIILGVAEGEFFIHDAEIQKSALQIIINCVCGP----DNR 704

  Fly   763 TSLI-KF--GTSSRKNKANHKYAEELIERVWESVCSNNGIVVLLSLMQTKGPITDADCIRGMACR 824
            .|.| ||  ||..||.....|.:|..:.::|..|.|||||.|||||:..|.||||||.||.:||:
Mouse   705 ISSIGKFISGTPRRKLSQTPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACK 769

  Fly   825 ALAGLARSDRVRQIVSKLPLFASGQLQTLMRDPILQEKRAEHVIFQKYALELLERVSGKTKPLNN 889
            ||.||:||..||||:||||||:|.|:|.||::|:||:||::||.|.|||.||:|||||  |||..
Mouse   770 ALVGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSG--KPLLI 832

  Fly   890 PLDPSLSNMHKANVIAQTRIQYNKQQLYQLIFEHLESNGLSQTAQMLQREVGLPLQTPTTRSFHQ 954
            ..|.||:.:.||:|:||:||.:.:::|..||..||.|.||.:||.:|.||..||:    |.:.|.
Mouse   833 GTDVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTREADLPM----TAASHS 893

  Fly   955 SPFDYKSLPSGSSSLSRNRLRSRMQDVNAAIMGNGDLNRSFGEDSSPA--------GA----GGS 1007
            |.|...:..:...||.|.   .|:.:..|:.:|:.....:....:.||        |:    |.|
Mouse   894 SAFTPVTAAASPVSLPRT---PRIANGIASRLGSHATVGASAPSAPPAHPPPRPPQGSLPLPGPS 955

  Fly  1008 NAGDGVSIPNFSSLNTTQTPI---KIR----RTDRSSVSRS--IQKQAMEPGGMSVGLAEDGQLH 1063
            .||:...|...|.:....:|.   |||    ::|..:.|:|  |:||.            |..| 
Mouse   956 YAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQL------------DRHL- 1007

  Fly  1064 PKRITLNTIVTEYLTNQHSLCNNPVTTCPQFDLYEPHKCPDPKPSRLLSSNYNLTSRHARTQA-- 1126
            |...||::|:||||..||:.|.|||.|||.|.|:.||:||:||..|  .:..|.|||..|..:  
Mouse  1008 PSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRR--QAPINFTSRLNRRASFP 1070

  Fly  1127 ---GFNTSRFDRRYVHTHFSPWRSIRSADYEDLEFTCCDLAG--KYIIVGTQQGDGRVFNMNDGV 1186
               |.:...|||..:.:.|.|....|.|:.::..||||..:.  :::::||..|..:::|:..|.
Mouse  1071 KYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQ 1135

  Fly  1187 EQFFSNCHNFSVDAIKANRAGDLVITSSFWRTPTSILWSIADDEFKLKLRLPDVTYCEFSQTVQD 1251
            |:...||||.::..::.:|.|.|::||:.|..|.|.||.: ...|.:|....:..|.|||:..||
Mouse  1136 EEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGM-KSVFDMKHSFTEDHYVEFSKHSQD 1199

  Fly  1252 RLLGTQNECATLFDINTGSKVAS-FTPTIPNLYTKNRATLCRTDELILSDGVLWDVRSGKEIHKF 1315
            |::||:.:.|.::||.||:|:.: |.|.:.|.|.:|.||...||:|:|:|||||||||.:.||||
Mouse  1200 RVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKF 1264

  Fly  1316 DKFNQCISGVFHPNCLEIIANTEVWDLRTFHLLQTVPVLDQRNCTFSPMH---VIYGASLGADRD 1377
            ||||..||||||||.||:|.|||:|||||||||.|||.|||....|:  |   |:|||.|.||.:
Mouse  1265 DKFNMNISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFN--HTGTVMYGAMLQADDE 1327

  Fly  1378 HDM----ETTTYDTSFNVLDAYDYSSIATIDVKRNINDLSVSANGSLIAVVEDYSGYES-KQETY 1437
            .|:    ..:.:.:||...:|.||..||||||||||.||........:||:|:....:: ..:|.
Mouse  1328 DDLLEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNMDTV 1392

  Fly  1438 VKIYAVGVKK--SERSEEEDDEEVPESDEDGSDTGSENTFAIGQNLLGFPLLRNLHGSDNDDEDL 1500
            .::|.||.::  .:..||||.||..:.:||                              |||| 
Mouse  1393 CRLYEVGRQRLAEDEDEEEDQEEEEQEEED------------------------------DDED- 1426

  Fly  1501 DEDDDDGEPLDSDD----DSDDDDGSDNGDDDGDFDVLEYFDRSSSDD 1544
            |:|.||.:.||:|.    :.::||.::|..:|||.|.      |.||:
Mouse  1427 DDDTDDLDELDTDQLLEAELEEDDNNENAGEDGDNDF------SPSDE 1468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mahjNP_001246451.1 LisH 912..944 CDD:128913 15/32 (47%)
WD40 1159..>1350 CDD:295369 91/194 (47%)
WD40 repeat 1159..1192 CDD:293791 9/35 (26%)
WD40 1194..>1423 CDD:225201 114/237 (48%)
WD40 repeat 1198..1236 CDD:293791 12/38 (32%)
WD40 repeat 1241..1278 CDD:293791 17/38 (45%)
WD40 repeat 1285..1316 CDD:293791 20/31 (65%)
WD40 repeat 1322..1352 CDD:293791 25/30 (83%)
Dcaf1XP_006511816.1 WD40 <1101..1380 CDD:225201 128/282 (45%)
WD40 1102..1320 CDD:295369 103/221 (47%)
WD40 repeat 1106..1142 CDD:293791 10/36 (28%)
WD40 repeat 1148..1230 CDD:293791 29/83 (35%)
WD40 repeat 1271..1301 CDD:293791 25/30 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345836853
eggNOG 1 0.900 E1_KOG1832
Hieranoid 1 1.000
Homologene 1 1.000 H8805
Inparanoid 1 1.050 930 1.000 Inparanoid score I346
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005421
OrthoInspector 1 1.000 T1085503
orthoMCL 1 0.900 OOG5_131556
Panther 1 1.100 LDO PTHR13129
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2475
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.