DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mahj and Dcaf1

Sequence 1:NP_001246451.1 Gene:mahj FlyBaseID:FBgn0034641 Length:1544 Species:Drosophila melanogaster
Sequence 2:NP_001341133.1 Gene:Dcaf1 RGDID:1305176 Length:1506 Species:Rattus norvegicus

Alignment Length:1547 Identity:591/1548 (38%)
Similarity:857/1548 (55%) Gaps:209/1548 (14%)


  Fly   109 TKKELTQIIDKWEQQQTQNGYDPVPTLRSLAEIFEREKDVYRRKDPDPLDSRHPYRADPSCQYGL 173
            :|.|||.::::||:.. .:|.|.||.|..::|:.|:|.:.||:.||||.|.|||.||||.|..|.
  Rat    10 SKAELTTLLEQWEKDH-GSGQDMVPILTRMSELIEKETEEYRKGDPDPFDDRHPGRADPECMLGH 73

  Fly   174 LLKLLFRKDTFMGKLLNDYLRENYFSRQNVSRSSLELNILACRLILEIMPGMETSAVFQTAEGDG 238
            ||::||:.|.||..|:|.|:.        .||.. .||..||||:|:||||:||:.|||  |.:|
  Rat    74 LLRILFKNDDFMNALVNAYVM--------TSREP-PLNTAACRLLLDIMPGLETAVVFQ--EKEG 127

  Fly   239 TINRIYSWAEDSIEPLQSYATGLLAEAMEVSDIAINFRDLNIRLVPKMIKRL------------- 290
            .:..::.||.::.:||::|:||||..|||..|||.|:||.|.:||..:::||             
  Rat   128 IVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLRELQLQEVALRQD 192

  Fly   291 -----------HMLLAISKSATS--------DVNTSMHNLSADSSTAGML-SWVACASNASAPQS 335
                       ..||.:.:.|..        ||.......|.|...:..| |....:|..::...
  Rat   193 NKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDVVDGEQEASRDMEISFRLDSSHKTSSRVNSATK 257

  Fly   336 PQHNGSGLGASSSQHGDASNM---------------SILFENSRDAFS-VSRYYKRMYIPLHPAT 384
            |:..|.... .|::|||..|.               .:..|.|..::| :|.:.......|:|.|
  Rat   258 PEEGGLKKN-KSAKHGDRENFRKAKQKLGFSSSDPDRVFVELSNSSWSEMSPWVIGTNYTLYPMT 321

  Fly   385 ADTSQMLIMRFLTSLGEYQEFLAMAFENNVMQLIFGYLENLDRRDTCLAYEVLKYLASLLCHKKF 449
            ....|.||:::||.||||||.|.:..:....:|:..|::.....|..|.:|.||:|||||.|.||
  Rat   322 PAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLLTFEALKHLASLLLHNKF 386

  Fly   450 ALEFISHGGLELLLKVPRPSLATTGVSIAIYYLAYCEDAMERICSMQRPLISELVRYALWILGRC 514
            |.||::|||::.||::||||:|.||||:.:|||:|.:|||||:|.....::|::|.|.||::...
  Rat   387 ATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYLSYNQDAMERVCMHPHNVLSDVVNYTLWLMECS 451

  Fly   515 HDSSKCHATMFFSLSFQFKVILDEFDAQDGLRKLYNVISVLKILDPSHNDSDNDSDFNEDVECAS 579
            |.|..||||||||:.|.|:.:|:.||..||||:|.|:||.|:||    |..|..:..::|...||
  Rat   452 HASGCCHATMFFSICFSFRAVLELFDRYDGLRRLVNLISTLEIL----NLEDQGALLSDDEIFAS 512

  Fly   580 RQMVRHVCVALKRYMEAHFFYKYNSF---LCQTNA---ASPAPSSAHYFNQNPTVAAKLTFDQLN 638
            ||..:|.|:||::|.|||...|....   |.:|..   ..|.|         |..|...|.:|:.
  Rat   513 RQTGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQP---------PYKACSYTHEQIV 568

  Fly   639 DQIRTLQEHTSIRAHWQPVDQLMKLGGITMLLRIIAFSYDW-VNSGRSETVRSALDVLSVCCIIP 702
            :.:..|.|:...:.:|:|.:..:||..:.:||::|:.:.:| ....|::|||.|||||::..::|
  Rat   569 EMMEFLIEYGPAQLYWEPAEVFLKLSCVQLLLQLISIACNWKTYYARNDTVRFALDVLAILTVVP 633

  Fly   703 RVYVVLCERLLMLDK----TTTSGFCSVLGAAAGE-ISSDAEVIKSALAVLCHCVCSPIIRKDSG 762
            ::.:.|.|.:.:||:    .:|.|...:||.|.|| ...|||:.||||.::.:|||.|    |:.
  Rat   634 KIQLQLAESVDVLDEAGSTVSTVGISIILGVAEGEFFIHDAEIQKSALQIIINCVCGP----DNR 694

  Fly   763 TSLI-KF--GTSSRKNKANHKYAEELIERVWESVCSNNGIVVLLSLMQTKGPITDADCIRGMACR 824
            .|.| ||  ||..||.....|.:|..:.::|..|.|||||.|||||:..|.||||||.||.:||:
  Rat   695 ISSIGKFISGTPRRKLSQTPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACK 759

  Fly   825 ALAGLARSDRVRQIVSKLPLFASGQLQTLMRDPILQEKRAEHVIFQKYALELLERVSGKTKPLNN 889
            ||.||:||..||||:||||||:|.|:|.||::|:||:||::||.|.|||.||:|||||  |||..
  Rat   760 ALVGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSG--KPLLI 822

  Fly   890 PLDPSLSNMHKANVIAQTRIQYNKQQLYQLIFEHLESNGLSQTAQMLQREVGLPLQTPTTRSFHQ 954
            ..|.||:.:.||:|:||:||.:.:::|..||..||.|.||.:||.:|.||..||:    |.:.|.
  Rat   823 GTDVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTREADLPM----TAASHS 883

  Fly   955 SPFDYKSLPSGSSSLSR-----NRLRSRMQDVNAAIMGNGDLNRSFGEDSSP------------- 1001
            |.|...:..:...||.|     |.:.||:.. :||:..:.        .|:|             
  Rat   884 SAFTPVTAAASPVSLPRTPRIANGIASRLGS-HAAVGASA--------PSAPPAHPPPRPPQGSL 939

  Fly  1002 AGAGGSNAGDGVSIPNFSSLNTTQTPI---KIR----RTDRSSVSRS--IQKQAMEPGGMSVGLA 1057
            |..|.|.||:...|...|.:....:|.   |||    ::|..:.|:|  |:||.           
  Rat   940 ALPGPSYAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQL----------- 993

  Fly  1058 EDGQLHPKRITLNTIVTEYLTNQHSLCNNPVTTCPQFDLYEPHKCPDPKPSRLLSSNYNLTSRHA 1122
             |..| |...||::|:||||..||:.|.|||.|||.|.|:.||:||:||..|  .:..|.|||..
  Rat   994 -DRHL-PSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRR--QAPINFTSRLN 1054

  Fly  1123 RTQA-----GFNTSRFDRRYVHTHFSPWRSIRSADYEDLEFTCCDLAG--KYIIVGTQQGDGRVF 1180
            |..:     |.:...|||..:.:.|.|....|.|:.::..||||..:.  :::::||..|..:::
  Rat  1055 RRASFPKYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLY 1119

  Fly  1181 NMNDGVEQFFSNCHNFSVDAIKANRAGDLVITSSFWRTPTSILWSIADDEFKLKLRLPDVTYCEF 1245
            |:..|.|:...||||.::..::.:|.|.|::||:.|..|.|.||.: ...|.:|....:..|.||
  Rat  1120 NVFSGQEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGM-KSVFDMKHSFTEDHYVEF 1183

  Fly  1246 SQTVQDRLLGTQNECATLFDINTGSKVAS-FTPTIPNLYTKNRATLCRTDELILSDGVLWDVRSG 1309
            |:..|||::||:.:.|.::||.||:|:.: |.|.:.|.|.:|.||...||:|:|:|||||||||.
  Rat  1184 SKHSQDRVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSA 1248

  Fly  1310 KEIHKFDKFNQCISGVFHPNCLEIIANTEVWDLRTFHLLQTVPVLDQRNCTFSPMH---VIYGAS 1371
            :.||||||||..||||||||.||:|.|||:|||||||||.|||.|||....|:  |   |:|||.
  Rat  1249 QAIHKFDKFNMNISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFN--HTGTVMYGAM 1311

  Fly  1372 LGADRDHDM----ETTTYDTSFNVLDAYDYSSIATIDVKRNINDLSVSANGSLIAVVEDYSGYES 1432
            |.||.:.|:    ..:.:.:||...:|.||..||||||||||.||........:||:|:....::
  Rat  1312 LQADDEDDLLEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDA 1376

  Fly  1433 -KQETYVKIYAVGVKKSERSEEEDDEEVPESDEDGSDTGSENTFAIGQNLLGFPLLRNLHGSDND 1496
             ..:|..::|.||  :...:|:||:||..|.:|.                           .:.|
  Rat  1377 LNMDTVCRLYEVG--RQRLAEDEDEEEDQEEEEQ---------------------------EEED 1412

  Fly  1497 DEDLDEDDDDGEPLDSDD----DSDDDDGSDNGDDDGDFDVLEYFDRSSSDD 1544
            |||.|:|.||.:.||:|.    :.::||.::|..:|||.|.      |.||:
  Rat  1413 DEDDDDDTDDLDELDTDQLLEAELEEDDNNENAGEDGDNDF------SPSDE 1458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mahjNP_001246451.1 LisH 912..944 CDD:128913 15/32 (47%)
WD40 1159..>1350 CDD:295369 91/194 (47%)
WD40 repeat 1159..1192 CDD:293791 9/35 (26%)
WD40 1194..>1423 CDD:225201 114/237 (48%)
WD40 repeat 1198..1236 CDD:293791 12/38 (32%)
WD40 repeat 1241..1278 CDD:293791 17/38 (45%)
WD40 repeat 1285..1316 CDD:293791 20/31 (65%)
WD40 repeat 1322..1352 CDD:293791 25/30 (83%)
Dcaf1NP_001341133.1 WD40 1092..1310 CDD:330360 103/221 (47%)
WD40 repeat 1096..1132 CDD:293791 10/36 (28%)
WD40 repeat 1138..1220 CDD:293791 29/83 (35%)
WD40 repeat 1261..1291 CDD:293791 25/30 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C345839498
eggNOG 1 0.900 E1_KOG1832
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8805
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D105679at2759
OrthoFinder 1 1.000 FOG0005421
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131556
Panther 1 1.100 LDO PTHR13129
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.