DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and PTP2

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_014851.3 Gene:PTP2 SGDID:S000005734 Length:750 Species:Saccharomyces cerevisiae

Alignment Length:991 Identity:204/992 (21%)
Similarity:304/992 (31%) Gaps:415/992 (42%)


  Fly   500 PKESP-FKQKSMDLP-MPTLQAKTTVSTSSMNLLQRRGSNHSLTLNLHSSCGNLMNSGLSHSNYS 562
            |.:.| ::.::::|. :|..|.|.......:|:.:...:.||..|.|....|...||.|.::|..
Yeast    39 PGQMPVYRGETINLSNLPQNQIKPCKDLDDVNIRRNNSNRHSKILLLDLCAGPNTNSFLGNTNAK 103

  Fly   563 LGSILNSKSSCNLDAGTASQIRADQLPQSHLLGSSQGSRQG--------------LFRRRGSNHS 613
            ..::|:......|       ::....|..:||.:..||.:.              :|....|..|
Yeast   104 DITVLSLPLPSTL-------VKRSNYPFENLLKNYLGSDEKYIEFTKIIKDYDIFIFSDSFSRIS 161

  Fly   614 ITLKTGHTTTSC------------------------GDLNSMQQLQQQQAMLSAEKYN------R 648
            ..||    ||.|                        |.||     ..:...|...|.|      .
Yeast   162 SCLK----TTFCLIEKFKKFICHFFPSPYLKFFLLEGSLN-----DSKAPSLGKNKKNCILPKLD 217

  Fly   649 LNMRTNSTG-SGSGSGSNVPTPKRGLLERRGSNQSLTLNMGSILGGAAGTEIQMTDIVQPKVTVC 712
            ||:..|.|. |......|:|.|          |.|..:.:.|:          ..|::.      
Yeast   218 LNLNVNLTSRSTLNLRINIPPP----------NDSNKIFLQSL----------KKDLIH------ 256

  Fly   713 SCAAANQAPHQRKFFSTENLNSSKANSQKFFGQVCFGSASDLQPNP-------QQDSVREDQAIG 770
                          :|..:|       ||||.   |...:||.||.       :..||:|::.: 
Yeast   257 --------------YSPNSL-------QKFFQ---FNMPADLAPNDTILPNWLKFCSVKENEKV- 296

  Fly   771 ATCTCAGTVRNIMTRPLSPQTTSEEFKIYLASIQMLQSASNPLNQFDLIRLNYVFDHSYQTNRNI 835
                       |:.:..:...|.|.|::.... :.|:....||:|..|          .|..|. 
Yeast   297 -----------ILKKLFNNFETLENFEMQRLE-KCLKFKKKPLHQKQL----------SQKQRG- 338

  Fly   836 IEQPPVLGSNARDVETPTDMVPPSSEDSELLASYQTVVSRMAQPIPELKENEQKRIFRDL----- 895
                                 |.|::||:|    .::.|...|....||.|.||.....|     
Yeast   339 ---------------------PQSTDDSKL----YSLTSLQRQYKSSLKSNIQKNQKLKLIIPKN 378

  Fly   896 ----------HKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLE--------SESSELT 942
                      ..:....|:|..|......|.|||||..|||.|:|||.|.        ||:|   
Yeast   379 NTSSSPSPLSSDDTIMSPINDYELTEGIQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEAS--- 440

  Fly   943 SLLGEIKRTSSVTASEDLP---------------YINANYIK----GPDYVSKCYVATQGPLPNT 988
                    |:.....:..|               ||||||:|    .||:.   |:|||.|||:|
Yeast   441 --------TTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK---YIATQAPLPST 494

  Fly   989 IFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYF---- 1049
            :.:||.:|..|..:.                           |:.|.:..|.|.:|..:|:    
Yeast   495 MDDFWKVITLNKVKV---------------------------IISLNSDDELNLRKWDIYWNNLS 532

  Fly  1050 ----PIELNEIFAVAAK---C--EVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHI 1105
                .|:|...:.....   |  .|||:...|                  ..:|.|..:....| 
Yeast   533 YSNHTIKLQNTWENICNINGCVLRVFQVKKTA------------------PQNDNISQDCDLPH- 578

  Fly  1106 GVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYH 1170
                     .|||.....|....|::                             |.||      
Yeast   579 ---------NGDLTSITMAVSEPFIV-----------------------------YQLQ------ 599

  Fly  1171 YWYPDWPDHHSPRDINTLLDTCLH-------------VLNLGKCESEFDIYDDTRSERNAHLAAQ 1222
              |.:|.|.... |:|.::.  ||             :.:|.|...:.|:.||..||  .||   
Yeast   600 --YKNWLDSCGV-DMNDIIK--LHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSE--LHL--- 654

  Fly  1223 RLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEY 1287
                   |..|: .|| ::|||||.||||.|..:            ..|..:|:.:...|:..:.
Yeast   655 -------DTANS-SPL-LVHCSAGCGRTGVFVTL------------DFLLSILSPTTNHSNKIDV 698

  Fly  1288 HNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCN-LRLQRGGMV 1351
            .|.|.                                          |::.|:.| ||.||..||
Yeast   699 WNMTQ------------------------------------------DLIFIIVNELRKQRISMV 721

  Fly  1352 QNSEQYELIHRAICLY 1367
            ||..||...:.|:..|
Yeast   722 QNLTQYIACYEALLNY 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 112/502 (22%)
PTPc 917..1364 CDD:238006 112/501 (22%)
PTP2NP_014851.3 COG5599 344..748 CDD:227886 128/576 (22%)
PTPc 410..736 CDD:238006 112/503 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19134
Phylome 1 0.910 0.692 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.