DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and T04F3.5

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001122998.2 Gene:T04F3.5 WormBaseID:WBGene00077538 Length:247 Species:Caenorhabditis elegans

Alignment Length:267 Identity:49/268 (18%)
Similarity:95/268 (35%) Gaps:83/268 (31%)


  Fly   657 GSGSGSGSNVPTPKRGLLERRGSNQSLTLNMGSILGG--AAGTEIQMTDIVQPKVTVCSCAAANQ 719
            |.|.|.|..:|             ..:::.|.:::|.  ..|.||:.:.|.|...:|......:|
 Worm    28 GMGMGMGMGMP-------------MVMSMPMHNLVGNPFEQGMEIEYSPITQLVSSVAHLVEMHQ 79

  Fly   720 APHQRK----------FFSTENLNSS------------KANSQKF----FGQVCFGSASDLQPNP 758
            ...:|:          |.....|.|.            ..|..:|    :.|...||:.....:.
 Worm    80 KSKEREEDHQNSHGPMFPEFSQLQSQMRRRPSISESGISLNGPRFNLIPYSQDGLGSSGSSTTSR 144

  Fly   759 QQDSVREDQAIGATCTCAGTVRNIMTR---PLSPQTTSEEFKIYLASIQMLQSASNPLNQ-FDLI 819
            ..:|:..|           |:..:|.|   .:....|:|:..:|    .|.:....|:.: .|..
 Worm   145 IINSISPD-----------TIPPVMWRIGDLIGKHDTNEKENLY----DMTKIKGFPITKSLDNE 194

  Fly   820 RLNYVFDHSYQTNRN--IIE-QPPVLGSNARDVETPTDMVPPSSEDSELLASYQTVVSRMAQPIP 881
            :|....|.:.::|::  ::| ...:||         .|.:|.::|.:.:           ||.|.
 Worm   195 KLFRDEDFANKSNKSWTVLEIARKMLG---------VDEIPTANEGNAI-----------AQLIE 239

  Fly   882 ELKENEQ 888
            ||::|::
 Worm   240 ELRKNKE 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528
PTPc 917..1364 CDD:238006
T04F3.5NP_001122998.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.