DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and ca16b

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:XP_001919055.3 Gene:ca16b ZFINID:ZDB-GENE-080818-1 Length:1382 Species:Danio rerio

Alignment Length:1283 Identity:245/1284 (19%)
Similarity:393/1284 (31%) Gaps:468/1284 (36%)


  Fly   251 EATRRDRSPALAEPPEQQ-------------QQKSEGRKNRKN---------KNNLTIRITDVPI 293
            |...|::||.....||.|             :.||..|...||         ||:..:|...:|.
Zfish    72 ECGERNQSPVDILDPETQVSQECQELTLDGFETKSSNRTTMKNTGKTVSIVLKNDYFVRGAGLPG 136

  Fly   294 K-------------NSSQPS--PLPKPKTPTIKS----TKEKARSLDSAANE----SELSIVVHN 335
            :             |.|..|  .:...|.|....    ..:...||.:|..|    :.:::....
Zfish   137 RFKAEKVEFHWGSTNGSAGSEHSINGKKFPVEMQIYFYNSDDFDSLSTAIKERRIIAAMAVFFQV 201

  Fly   336 ITESHGSCDDMETGQSQPSTSVIHHHLHLQQPASAIHSTSLSRLDSHLSLANQRRTPRRKSPGIN 400
            .|:.:.:.:.:..|..:    |:||.......:..:.....|.|.|:........||    |...
Zfish   202 ATKDNIAAEPIIAGLKR----VVHHEKETNLGSFILRDLLPSSLGSYYRYTGSLTTP----PCSK 258

  Fly   401 TTDW--------LMYHRKQNPYQV----QPTHCSSTTQ--------SSLDS---------DA--- 433
            ..:|        |.||:.:..|.:    |..|..|...        ..|||         ||   
Zfish   259 VVEWIIFSRPVYLSYHQLEAFYSIFTTEQQDHVKSVDYLRNNHRPIQDLDSRRIFKSALMDAWMP 323

  Fly   434 SLTPSLGDFELKSACSVDGGSKFGIGASLAPRSAHKHNQLLHSSSTNLKTL----PECL---TLV 491
            ....|..|.|....|                 |:...|..||..:.....|    |..:   .:|
Zfish   324 ETMASAADTETSRVC-----------------SSIPDNMKLHPLNRTALVLTWDRPSAVYHPPIV 371

  Fly   492 EFSSSGGGPK-ESPFKQKSMDLPMPTLQAKTTVSTSSMNLLQR--------RGSNHSLTL----- 542
            .|..|....| |.||::........:.:|..|:.:..:..|.|        :.|:.|.||     
Zfish   372 GFLVSYSWVKDEMPFEKTFTQSSEHSTRAVITLVSPDVLYLFRVQALCQRDQRSDFSQTLLFKAN 436

  Fly   543 ---------------------------NLHSSCGNLMNSGLSHSNYSLGSILNSKSSCNLDAGTA 580
                                       .:.|......::||..|..|:.:.:...||.. .|..|
Zfish   437 TTRIFEGTRIVKTGMPTVSPASSADMAPISSGSSTWTSAGLPFSFVSMATGMGPPSSGG-QATVA 500

  Fly   581 SQIRADQLPQSHLLGSSQGSRQGLFRRRGSNHSITLKTGHTTT----------SCGDLNSMQQLQ 635
            |.:.:..|......||...|..|.|....|.::....|.|..|          |....|.:::.:
Zfish   501 SVVTSTLLAGLGFSGSVISSLPGSFWPTHSTNTGPSPTQHPATPTAENSPSEDSTDTQNKLEEEE 565

  Fly   636 QQQAMLSAEKYNRLNMRTNSTGSGSGSGSNV----------------PTPKRGLLERRGSNQSLT 684
            :.:.....|:.................|.:|                ||.|....||..: :|.|
Zfish   566 EHKKEDDEEEEEEEEEEEQRDEEKKKKGKDVTVKDKKQTVQKPTAPIPTSKHRDRERPDA-ESST 629

  Fly   685 LNMGSILGGAAGTEIQMTDIVQPKVTVCSCAAANQAPHQRKFFSTENLNSSKANSQKFFGQVCFG 749
            |....:....:|                    |.:.|...        :||||..|         
Zfish   630 LTPAEVEEQVSG--------------------ATERPDAE--------DSSKATWQ--------- 657

  Fly   750 SASDLQ-PNPQQDSVR-EDQAIGATCTCAGTVRNIMTRPLSPQTTSEEFKIYLASIQMLQSASNP 812
            ..:|:| |:...:|.: .|:..........|.||.:: .:|..:.|...::......|:.||...
Zfish   658 DDNDMQIPSSSTESSKLSDEEKANWPYYINTERNSIS-TVSRDSVSSSSRMEWIIPLMVVSALTL 721

  Fly   813 LNQFDLIRLNYVFDHSYQTNRNIIEQPPVLGSNARDVETPTDMVPPSSEDSELLASYQTVVSRMA 877
            |....|:.:...:...:||....||.    .::.|.:...:..:..:::|.|.:.     |.:..
Zfish   722 LCLIMLLAVLVYWRRFFQTAHFYIED----RNSPRVIHNDSFPIISTADDLEAMP-----VRQFI 777

  Fly   878 QPIPELKENEQKRIFRDLHKEFWDLP------------LNHQEKPMVFGSQTKNRYKTILPNENS 930
            :.|.||..|.:    ....:||.::.            .||.|      ::.||||..|:..::|
Zfish   778 KHIMELHSNNR----HGFSQEFDEVQHCTSEMKITAEHSNHPE------NKHKNRYINIVAYDHS 832

  Fly   931 RVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYV-SKCYVATQGPLPNTIFEFWL 994
            ||       :|..|.|:..:.|.        ||||||:.|  |. ::.|:|.||||.:|..:||.
Zfish   833 RV-------KLQQLPGKDSKHSD--------YINANYVDG--YKRARAYIAAQGPLKSTFEDFWR 880

  Fly   995 MIY-QNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFA 1058
            ||: |||                            ..|||:||..|..|:||..|:|.|.:|::.
Zfish   881 MIWEQNT----------------------------TVIVMITNLVEKGRRKCDQYWPSENSEVYG 917

  Fly  1059 VAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALP 1123
                                                              ::.|||:...:.|..
Zfish   918 --------------------------------------------------NIMVTLKSTKVYAYY 932

  Fly  1124 AQGSFFLIKNVGIVR-RNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINT 1187
            .. ..|:::|..:.: :.|....:|||          .||          |..|||...|     
Zfish   933 TL-RHFIVRNSKLKKGQKGRQNERLVL----------QYH----------YTQWPDMGVP----- 971

  Fly  1188 LLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV-IHCSAGIGRTG 1251
              :..|.||..                           |.:..:.:|....|| :|||||:||||
Zfish   972 --EYTLPVLKF---------------------------ISRSTVTHASSTGPVLVHCSAGVGRTG 1007

  Fly  1252 CFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEA 1316
            .:..|.:.::|::                           |..|                     
Zfish  1008 TYIVIDSMLKQIK---------------------------DRGS--------------------- 1024

  Fly  1317 VKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAI 1364
                             |:|||.:.::|.||..:||..||:..||.|:
Zfish  1025 -----------------VNVLGFLKHIREQRNYLVQTEEQFIFIHDAL 1055

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 98/452 (22%)
PTPc 917..1364 CDD:238006 98/451 (22%)
ca16bXP_001919055.3 alpha_CARP_receptor_like 62..314 CDD:239396 47/250 (19%)
FN3 340..417 CDD:214495 16/77 (21%)
Herpes_BLLF1 450..>557 CDD:330317 21/108 (19%)
PTPc 790..1057 CDD:214550 103/488 (21%)
PTPc 1089..1347 CDD:214550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.