DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and ptprz1a

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:XP_005163194.1 Gene:ptprz1a ZFINID:ZDB-GENE-090406-1 Length:1827 Species:Danio rerio

Alignment Length:1483 Identity:300/1484 (20%)
Similarity:480/1484 (32%) Gaps:518/1484 (35%)


  Fly    10 ENAPIEYPYPQT---PRPT------HAAPSDT-------TPLEAGEDAESNKSTPYFTPLEYLQT 58
            |...:.||:..|   ||.|      |.....|       .|:|     ||.|:.....|:.|.. 
Zfish   443 ETERLPYPFQTTTTSPRVTTTERLIHPVVKTTQRTHERRLPVE-----ESQKTHDDIFPVVYTD- 501

  Fly    59 SFEFPSPTVEVGGGVPGFPEHEDQ----------EEEVFTPRQFT-ITSPHPAAHVHHPSSSQSP 112
                 .||.          :|.||          :....||..|. |......:.|...|.:.||
Zfish   502 -----KPTA----------KHTDQPTTITTTFVVDVHTTTPDSFRFIAGVSSESDVQSSSFTDSP 551

  Fly   113 TLGRKFKRLSQYDRRSCSPHINTSSGEER-VSGRGIDKENTMPKGGSVDQDLENSLYLSKS-EHN 175
            |              |.:|  .||...|| |:...||....        :|:...:.::.| |.:
Zfish   552 T--------------SVTP--ETSETLERFVTSASIDILEV--------EDVTEPVTITDSFEES 592

  Fly   176 SPTIL------FKDESSTTPG------LEASRLSYSPKLLSSINNLNVSGSPLNIINSAGYKNGN 228
            |.|:.      ....|||.|.      ..||....:....|::  |:.:..|:....||.|.   
Zfish   593 SQTVAPLLEIPVDSTSSTFPSEVPLWPTTASLPFPATAAFSTV--LSQTTQPVFNGESAPYA--- 652

  Fly   229 FFRFPEIDHV---VQDAPMDTVCLEEATRRDRSPALAEPPEQQQQKSEGRKNRKNKNNLTIRITD 290
                |.:...   |..:|:....|        |..|:||                     |...|
Zfish   653 ----PSVSDTLSYVHASPVSPYSL--------SSVLSEP---------------------IPDWD 684

  Fly   291 VP-----IKNSSQPSPLPKPKTPTIKSTKEKARSLDSAANESELSIVVHNITESHGSC-----DD 345
            :|     :.:....|..|.|..||:        ||..:.:..::..|      |.|.|     ||
Zfish   685 IPYTVTMLVSGGAQSITPSPSYPTL--------SLSGSVSYLDMESV------SSGGCIDDDGDD 735

  Fly   346 METGQSQPSTSVIHHHLHLQ---------QPASAIHSTSLSRLDSHLSLANQRRTPRRKSPGINT 401
            .....|..:.......|.||         .|......:||..|..|....:...||....|.:..
Zfish   736 AVLSGSASADPPCRTTLPLQTLSEVTASVDPMLPSSESSLLHLSEHSGTISVLSTPAYLQPSVPV 800

  Fly   402 T-DWLMYHRKQNPYQVQPTHCSSTTQSSLDSDASLTPSLGDFEL------KSACSVDGGSKFGIG 459
            : |:                  |||.::||:||||..|.|:..|      .|..:....|||.:.
Zfish   801 SKDY------------------STTTTTLDTDASLLGSNGESNLLTEWVDSSLAAPTFSSKFSLH 847

  Fly   460 ASLAPRSAHKHNQLLHSSSTNLKTLPECLTLVE-------FSSSGGGPKESPFKQKSMDLPMPTL 517
            ||        .|.||.||   :..||.|.:|:.       |.|:... ..|......:||....|
Zfish   848 AS--------SNSLLPSS---VSGLPPCSSLLSNPVELHLFQSTSSA-STSLCSDAGLDLSTKAL 900

  Fly   518 QAKTTVSTSSMNLLQRRGSNHSLTLNLHSSCGNLMNSGLSHSNYSLGSILNSKSSCNLDAGTASQ 582
            ....::||.         .:..|:|::.::..|:..|.:..|                 .|.::.
Zfish   901 LPSLSISTK---------PSSDLSLSVAATVNNIAQSAIGQS-----------------LGASAP 939

  Fly   583 IRADQLPQSHLLGSSQGSRQGLFRRRGSNHSITLKTGHTTTSCGDLNSMQQLQQQQAMLSAEKYN 647
            ||:..:..:.:|           ..|.:...:...|...|:....:..:..:......:|:    
Zfish   940 IRSSAITTTPIL-----------ELRSTPTPVVPPTIAPTSPSDSITVVAPVVPPTIPVSS---- 989

  Fly   648 RLNMRTNSTGSGSGSGSNVPTPKR-GLLERRGSNQSLTLNMGSILGGAAGTEIQMTDIVQPKVTV 711
                        :...|::||... |..|...|..:..|:.|.  ..|:|.|    .|..|.:|.
Zfish   990 ------------APESSSMPTHSADGQQENSASGWTFDLDWGQ--SSASGDE----SIAAPYITT 1036

  Fly   712 CSCAAANQAPHQRKFFSTENLNSSKANSQKFFGQVCFGSASD-------LQPNPQ---QDSVRED 766
            .|  ....:|.:     |::.|...::|..|.|:  .|:.|:       |||:|.   :.|..|:
Zfish  1037 AS--PTEVSPEE-----TDDGNEEHSSSFYFEGE--NGTESEVTDFRVTLQPSPSWTLRGSWEEE 1092

  Fly   767 QAIGATCT----------CAGTVRNIMTRPL-SPQTTSEEFKIYLA-SIQMLQSASNP------- 812
            ...|.|.|          ...|.|.....|: ....:|.|.::.|| ||:..:.|..|       
Zfish  1093 SGSGETLTDNETSSDFSIPERTERESEEEPVEDANNSSHESRVGLASSIERQKKAVVPLAVVSTL 1157

  Fly   813 --LNQFDLIRLNYVFDHSYQTNRNIIE---QPPVLGSNARDVETPTDMVPPSSEDSELLASYQTV 872
              |....||.:...:...:||....||   .|.|:.|        ..::.|:.|...|      .
Zfish  1158 TFLGLIFLIGIYIYWRKCFQTAHFYIEDSTSPRVISS--------LPLLNPTGEHEPL------P 1208

  Fly   873 VSRMAQPIPELKENEQ-KRIFRDLHKEFWDLPL------------NHQEKPMVFGSQTKNRYKTI 924
            |.:....:.||..... .|.|..|.:.|.::..            ||.:      ::.||||..|
Zfish  1209 VKQFVNHVTELHNTSSFSREFEILKEYFEEVQTCTVDLGTTTDCSNHPD------NKNKNRYVNI 1267

  Fly   925 LPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTI 989
            |..::|||.|...:.:.....|:              ||||||:.|.: .:|.|:|.||||.::.
Zfish  1268 LAYDHSRVRLAPLNDKDGKSGGD--------------YINANYVDGFN-KNKAYIAAQGPLKSST 1317

  Fly   990 FEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELN 1054
            .:||.|::                           :|....|||:||..|..|:||..|:|:|..
Zfish  1318 PDFWRMVW---------------------------EQNVGVIVMITNLVEKGRKKCDQYWPLENR 1355

  Fly  1055 EIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLL 1119
            |.:.    |  |.::..:.:....|...||.                                  
Zfish  1356 EEYG----C--FLVTVKSTNVLAYYTKRTFT---------------------------------- 1380

  Fly  1120 EALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRD 1184
                       ::|.        |::|          .|..|...:.....|.|..|||...|..
Zfish  1381 -----------LRNT--------SIKK----------GSQRYRSNERTVTQYHYTQWPDMGVPEY 1416

  Fly  1185 INTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGR 1249
            :       |.||:.        :|..::::.                 :.:.|: |:|||||:||
Zfish  1417 V-------LPVLSF--------VYKSSKAQT-----------------DGMGPM-VVHCSAGVGR 1448

  Fly  1250 TGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSS----TEEYHNPTDS---DSSFTCNTIRHISH 1307
            ||.:..:.:.::|:::....::.|.|....|..:    |||.:..|..   ::..:..|....||
Zfish  1449 TGTYIVLDSMLKQIKEKGTVNIMGFLKHIRTQRNYLVQTEEQYIFTHDALVEAILSQETEVSSSH 1513

  Fly  1308 ILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELI 1360
            |  |:....:.||                 |..|..||::        |::|:
Zfish  1514 I--HQYVNNLLTP-----------------GASCKTRLEK--------QFKLV 1539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 94/453 (21%)
PTPc 917..1364 CDD:238006 94/452 (21%)
ptprz1aXP_005163194.1 alpha_CARP_receptor_like 48..301 CDD:239396
fn3 316..398 CDD:278470
PTPc 1225..1500 CDD:214550 87/425 (20%)
PTPc 1261..1500 CDD:238006 81/383 (21%)
PTPc 1532..1791 CDD:214550 3/17 (18%)
PTPc 1559..1791 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.