DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and mop

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_648722.2 Gene:mop FlyBaseID:FBgn0036448 Length:1833 Species:Drosophila melanogaster

Alignment Length:1087 Identity:219/1088 (20%)
Similarity:349/1088 (32%) Gaps:304/1088 (28%)


  Fly     7 NNKENAPIEYPYP-QTPRPTHAAPSDTTPLEAGEDAESNKSTPYFTPLEYLQTSFEFPSPTVEVG 70
            :|....|...|.| .:..||.||.|..|       |..|:..|   |....|..:..||      
  Fly   754 SNPAYVPTVRPVPVGSENPTQAACSYAT-------APPNEPPP---PYSLTQQQYFDPS------ 802

  Fly    71 GGVPGF--PEHEDQEEEVFTPRQFTITSPHPAAHVHHPSSSQSPTLGRKFKRLSQYDRRSCSPHI 133
              ..|:  |.::.|::.:..|......||:        |.:....||:...:....|........
  Fly   803 --AAGYTNPMYQQQQQHIAPPAYKAQASPN--------SQTLHGALGQMNLQGQSQDNNQAGMAY 857

  Fly   134 NTSSGEERVSGRGIDKENTMP-KGGSVDQDLENSLYLSKSEHNSPTILFKDESSTTPGLEASRLS 197
            |.......|.........|:| ...|...:::..||::.|  .:|             :..|..|
  Fly   858 NYGYPSGSVPPLAYAPPGTVPASSASQGLNIQQPLYVATS--GNP-------------VSVSNPS 907

  Fly   198 YSPKLLSSINNLNVSGSPLNIINSAGYKNGNFFRFPEIDHVVQDAPMDTVCLEEATRRDRSPALA 262
            ..|..|.:...:|...:|..  .:||| :|..::  :::...|.....|.....:|.:.....|.
  Fly   908 ELPSTLQAPFVVNPMSNPYQ--TAAGY-SGQAYQ--QVNAQAQQVTYPTAPSGSSTGQSAQQPLG 967

  Fly   263 EPPEQ-QQQKSEGRKNRKNKNNLTIRITDVPIKNSSQPSPLPKPKTPTIKSTKEKARSLDSAANE 326
            ..|.| .||::.|....:............|:...:| ...|:.:|...:|...:.::...|.|:
  Fly   968 YAPSQGPQQQAGGYPQSQTPQQQVGAYQQQPLSGYAQ-QLTPQQQTGYSQSQAPQLQAPSYAQNQ 1031

  Fly   327 SELSIVVHNITESHGSCDDMETGQSQPSTSVIHHHLHLQQPASAIHSTSLSRLDSHLSLANQRRT 391
                       :|.|.....:||..|.....:..:...||.|:..               .|.:|
  Fly  1032 -----------QSTGQAQQQQTGYPQTPQQHLAGYAQSQQQATGY---------------PQSQT 1070

  Fly   392 PRRKSPGINTTDWLMYHRKQNP-----YQVQPT-HCSSTTQSSL-DSDASLTPSLGDFELKSACS 449
            .::::.|        |.:.|.|     ||.||: :.....|.|| ....||.||.         :
  Fly  1071 SQQQTTG--------YSQSQTPQQPLAYQQQPSGYPQQQQQQSLAPQQPSLYPSQ---------A 1118

  Fly   450 VDGGSKFGIGASLAPRSAHKHNQLLHSSSTNLKTLPECLTLVEFSSSGGGPKESPFKQKSMDLPM 514
            |....:...|....|.:|   .|.|        ..|:     :::.....|..:| ...|:..|:
  Fly  1119 VQASPQPIPGQQATPPNA---GQPL--------PYPQ-----QYTDPNAAPAPAP-GVSSVPSPV 1166

  Fly   515 PTLQAKTTVSTSSMNLLQRRGSNH-SLTLNLHSSCGNLMNSGLSHSNYSLGSILNSKSSCNLDAG 578
            |   ..|...|||.  .|...|.| |.|...:|          :|..||.          |...|
  Fly  1167 P---VPTPAPTSSQ--AQVPTSPHPSATYTSYS----------NHPGYSF----------NPQTG 1206

  Fly   579 TASQIRADQLPQSHLLGSSQGSRQGLFRRRGSNHSI-----------TLKTG-------HTTTSC 625
            ........|...|.|.| ||.|:...|.:.|...|:           ...||       ||..:.
  Fly  1207 KYEYSSGYQQDTSSLKG-SQASQSYQFSQSGKQQSVGTTDSEIASRSNTATGFDSPIVSHTKVNM 1270

  Fly   626 GDLNSMQQLQQQQAMLSAEKYNRLNMRTNSTGSGSGSGSNVPTPKRGLLERRGSNQSLTLNMGSI 690
            ...:|...::..:   |:..|:     |.....||.:....|||      ...||.:.::.|.| 
  Fly  1271 AAKDSTSAIEGNE---SSNYYS-----TPYGYLGSVNPQQQPTP------APPSNSTASIYMQS- 1320

  Fly   691 LGGAAGTEIQMT-------------------DIVQPKVTV---------CSCAAANQAPH----- 722
             |.::..|.|.|                   :.:.||||.         ..|:.|...|.     
  Fly  1321 -GASSTAETQTTSSGVPYASSAALTKVEPKPEALPPKVTSNVDLLSDLDIDCSVAVPPPMLPQPV 1384

  Fly   723 -QRKFFSTENLNSSKANSQKFFGQVCFGSASDLQPNPQQDSVREDQA-------IGATCTCAGTV 779
             |.:..:|..                 ..||.:....:.:||.|..|       :.||   .||.
  Fly  1385 LQPQVVATPT-----------------PPASQVSVPVKVESVAEHAAPATAEIPVAAT---EGTA 1429

  Fly   780 RNIMTRPLSPQTTSEEFKIYLASIQMLQSASNPLNQFDLIRL-NYVFDHSYQTNRNIIEQPPVLG 843
            :..:|.|..|:         .||:..|.:.|      ||..| |:.:| |.....::.|:.....
  Fly  1430 QTPVTIPSGPK---------CASLDNLSNCS------DLSSLENFDWD-SVSVTHSVSEKQTKAS 1478

  Fly   844 SNAR--------DVETPTDMVPPSSEDSELLASYQTVVSRM--------AQPIPELKENEQKRIF 892
            :.|.        ..||.||.........| :.||:.::..:        .|...:.:|.:||   
  Fly  1479 ATANGHSSSFAFQSETFTDEKTTKYFQKE-VESYEKLLENLHVKMLNGKTQLGAKWQELQQK--- 1539

  Fly   893 RDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTAS 957
              |.||   ...|.:...:......|||....||.:::||.|:.::.:                 
  Fly  1540 --LDKE---AAANKRSTTIAKLFPEKNRSLDCLPYDHARVKLDKQTDD----------------- 1582

  Fly   958 EDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYI 1004
                ||||.|:|........::..|.|.||||.:||.||:....|.:
  Fly  1583 ----YINAAYMKNLSAGCPNFIVAQTPQPNTINDFWSMIWSEKSRTV 1625

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 25/90 (28%)
PTPc 917..1364 CDD:238006 25/89 (28%)
mopNP_648722.2 BRO1_HD-PTP_like 2..363 CDD:185762
V_HD-PTP_like 368..702 CDD:185747
ALIX_LYPXL_bnd 421..699 CDD:290660
Med15 808..>1246 CDD:255446 106/553 (19%)
Y_phosphatase 1558..1788 CDD:278528 25/90 (28%)
PTPc 1559..1745 CDD:238006 25/89 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.