DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and ptpn2a

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_956760.2 Gene:ptpn2a ZFINID:ZDB-GENE-040426-1196 Length:392 Species:Danio rerio

Alignment Length:480 Identity:90/481 (19%)
Similarity:147/481 (31%) Gaps:222/481 (46%)


  Fly   887 EQKRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRT 951
            |.:.::.:||.:..:......:.|   .:..:|||:.:.|.::|||.||:..::           
Zfish    13 EWQNLYNELHNQSQERSYKVAKFP---ENCNRNRYRDVSPYDHSRVKLENSEND----------- 63

  Fly   952 SSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSP 1016
                      ||||:.|. .:...:.|:.|||||.||...||||:::.           ||.:  
Zfish    64 ----------YINASLIT-MEEAQRRYILTQGPLKNTCGHFWLMVWEQ-----------GSKA-- 104

  Fly  1017 HVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLT 1081
                          ::||....|...:|||.|:|                     :::..|...:
Zfish   105 --------------VIMLNRVIEKGTEKCAQYWP---------------------SKEEQDMNFS 134

  Fly  1082 PTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYS--V 1144
            .|....|:|.                |.||......|||.                 :||.:  .
Zfish   135 DTGFMVTLVC----------------EDVKPNYTIRLLEL-----------------QNGKTGET 166

  Fly  1145 RKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYD 1209
            |.:                     ||:.|..|||...|....:.||....|...|....|     
Zfish   167 RDI---------------------YHFHYTAWPDFGVPESPASFLDFLFKVRESGSLGPE----- 205

  Fly  1210 DTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGM 1274
                  |..:                    |:||||||||:|.|:.:                  
Zfish   206 ------NGPV--------------------VVHCSAGIGRSGSFSLV------------------ 226

  Fly  1275 LTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGI 1339
                                  .||..      ::|.|:        .|        :.||:..:
Zfish   227 ----------------------DTCLV------LMDQRN--------DF--------LAVDIQKV 247

  Fly  1340 VCNLRLQRGGMVQNSEQYELIHRAI 1364
            :.::|..|.|::|..:|....:.|:
Zfish   248 LLDMREYRMGLIQTPDQLRFSYMAV 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 86/450 (19%)
PTPc 917..1364 CDD:238006 86/449 (19%)
ptpn2aNP_956760.2 PTPc 11..274 CDD:214550 90/481 (19%)
PTPc 41..274 CDD:238006 86/450 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.