DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and Ptp4E

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001162669.1 Gene:Ptp4E FlyBaseID:FBgn0004368 Length:1767 Species:Drosophila melanogaster

Alignment Length:1723 Identity:311/1724 (18%)
Similarity:506/1724 (29%) Gaps:716/1724 (42%)


  Fly    34 PLEAGEDAESNKSTPYFTPLEYLQTSFEFPSPTVEVGGG--VPGFPEHEDQEEEVFTPRQFTI-- 94
            |.|.....|.|         |.||.|.:..:|    ||.  |..:..::.:|...:|.|.||.  
  Fly   193 PFERSYSLEGN---------ETLQLSAKELTP----GGSYQVQAYSVYQGKESVAYTSRNFTTKP 244

  Fly    95 --------------------TSPHPAAHVHHPSSSQSPTLGRKFKRLSQYDRRSCSPHINTSSGE 139
                                ..|.||....|...|.:|  ....:.:...:|....|....::.:
  Fly   245 NTPGKFIVWFRNETTLLVLWQPPFPAGIYTHYRVSITP--DDAIQSVLYVEREGEPPGPAQAAFK 307

  Fly   140 ERVSGRGIDKENTMPKGGSVDQDLENSL-----YLSKSEHNSPTILFKDESSTTPGLEASRLSYS 199
            ..|.||   :.|...:  :|.:|..:|:     ||:..| ....:.| ||:.||.  .:.|:.:.
  Fly   308 GLVPGR---EYNISVQ--TVSEDETSSVPTTARYLTVPE-RVLNVTF-DEAYTTS--SSFRVRWE 363

  Fly   200 -PKLLSSINNLNVS-GSPLNIINSAGYKNGN--FFRFPEI------DHVVQDAPMDTV----CLE 250
             |:..|..:...|. .:...|.|.....||:  :|.:|:|      ..||.....|.|    ...
  Fly   364 PPRTYSEFDAYQVMLSTSRRIFNVPRAANGDSVYFDYPDILEPGRTYEVVVKTIADNVNSWPASG 428

  Fly   251 EATRR------------DRSPALA---EPPEQQQQKSEGRKNRKNKN--------------NLTI 286
            |.|.|            |||.||.   ||.|..:|.|......:..|              .:|.
  Fly   429 EVTLRPRPVRSLGGFLDDRSNALHISWEPAETGRQDSYRISYHEQTNASEVPAPFPVAAESQITT 493

  Fly   287 RITDVPI---------------------KNSSQPSPLPKPKTPTIKSTKEKARSLDS-------- 322
            .:|:..:                     .|:|..:...:|..|.|    ::.||:|.        
  Fly   494 NLTEYTLDSLLAGRRYLIAVQALSKGVASNASDITRYTRPAAPLI----QELRSIDQGLMLSWRS 554

  Fly   323 ------------------------AANESELSI-----------VVHNITESHGSCDDMETGQSQ 352
                                    |.||:.|:|           .||.|  |||.       :|:
  Fly   555 DVNSRQDRYEVHYQRNGTREERTMATNETSLTIHYLHPGSGYEVKVHAI--SHGV-------RSE 610

  Fly   353 P---------------STSVIHHH---LHLQQPASAIHSTSLSRLDSHLSLANQRRTPRRKSPGI 399
            |               :...:|.:   ||.|.|..:..|..:.|..:..|       |.::..|:
  Fly   611 PHSYFQAVFPKPPQNLTLQTVHTNLVVLHWQAPEGSDFSEYVVRYRTDAS-------PWQRISGL 668

  Fly   400 NTTDWLMYHRKQNPYQVQPTHCSSTTQSSLDSDASLTPSLGDFELKSACSVDGGSKFGIGASLAP 464
            :          :|..:::..|........::     |.|.|         |:......:..::.|
  Fly   669 H----------ENEARIKDMHYGERYLVQVN-----TVSFG---------VESPHPLELNVTMPP 709

  Fly   465 RSAHKHNQLLHSSSTNLKTLPECLTLVEFSSSGGGPKES----PFKQKSM--DLPMPTLQ----- 518
            :.......|:.|.:..|: .|.....|:|.:....|.:.    .||..:.  ||..|:::     
  Fly   710 QPVSNVVPLVDSRNLTLE-WPRPDGHVDFYTLKWWPTDEEDRVEFKNVTQLEDLSSPSVRIPIED 773

  Fly   519 --------------------AKTTVSTSSMNLLQ----------RRGSNHSLTLNL--------- 544
                                ..|.:||.:|.|:|          .:|.:.::||:.         
  Fly   774 LSPGRQYRFEVQASSNGIRSGTTHLSTRTMPLIQSDVFIANAGHEQGQDETITLSYTPTPADSTR 838

  Fly   545 ---------------HSSCGNLMNSGLSHSNYSLGSILNSKSSCNLDAGTAS-----QIRADQLP 589
                           .....|.....||.|..:.|.:.| .:...:..|.||     ..|...||
  Fly   839 FDIYRFSMGDPTIKDKEKLANDTERKLSFSGLTPGKLYN-VTVWTVSGGVASLPVQRLYRLHPLP 902

  Fly   590 QSHLLGSSQGSRQGLFRRRGSNHSITLKTGHTTTSCGDLN--SMQQL----QQQQAMLSAEKYNR 648
            .|.|......:|:           |||   |.|...|:..  .:|.|    :..|.:.:..|...
  Fly   903 ISDLKAIQVAARE-----------ITL---HWTAPAGEYTDFELQYLSADEEAPQLLQNVTKNTE 953

  Fly   649 LNMR----------TNSTGSGSGSGS-----NVPTPKRGLLERRGSNQSLTLNMGSILGGAAGTE 698
            :.::          |....|||..|:     :|.|..|.......|.|:||...|.:      ..
  Fly   954 ITLQGLRPYHNYTFTVVVRSGSIQGTDFADVSVSTLMRSSAPISASYQTLTAPPGKV------DY 1012

  Fly   699 IQMTDIVQPKVTV-CSCAAANQ-APHQRKFFSTENL-NSSKANSQKFFGQVCFGSASDLQP-NPQ 759
            .|.:|:...:||. .|...|.| .|......:.:|. :::..:|.:|......|....|.| |..
  Fly  1013 FQPSDVQPGEVTFEWSLEPAEQHGPIDYFRITCQNADDAADVSSYEFPVNATQGKIDGLVPGNHY 1077

  Fly   760 QDSVREDQAIGATCTCAGTVR-NIMTRPL------SPQTTSEEFKIYLASIQMLQSASNPLNQFD 817
            ...::...|:|     .|..| :|.|.|:      .|..|..|.....::|::........|...
  Fly  1078 IFRIQAKSALG-----YGAEREHIQTMPILAPPVPEPSVTPLEVSRTSSTIEISFRQGYFSNAHG 1137

  Fly   818 LIRLNYVFDHSYQTNRNI--IEQP---------------------PVLGSNA------------- 846
            ::| :|....:....:|.  :|.|                     |.|.||.             
  Fly  1138 MVR-SYTIIIAEDVGKNASGLEMPSWQDVQAYTVWLPYQAIEPYNPFLTSNGSRKSSLEAEHFTI 1201

  Fly   847 ------------------------------RDVETPTDMV---PPSSEDSELLASYQTV------ 872
                                          .|.:..||.|   |.::|.|:.:....||      
  Fly  1202 GTANCDKHQAGYCNGPLRAGTTYRIKIRAFTDEDKFTDTVYSSPITTERSDTVIVAATVSAVLLV 1266

  Fly   873 ---------------------VSRMAQPIPELKE------------------------------- 885
                                 ::||...:..|.|                               
  Fly  1267 AMVLVVVYCQHRCQLIRRASKLARMQDELAALPEGYITPNRPVHVKDFSEHYRIMSADSDFRFSE 1331

  Fly   886 --NEQKRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEI 948
              .|.|.:.||....|.:||.|          :.|||:..|||.::||..|:             
  Fly  1332 EFEELKHVGRDQACSFANLPCN----------RPKNRFTNILPYDHSRFKLQ------------- 1373

  Fly   949 KRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSS 1013
                .|...:...||||||:.|.:...: ::.|||||.:|..|||.|.:::..|           
  Fly  1374 ----PVDDDDGSDYINANYMPGHNSPRE-FIVTQGPLHSTREEFWRMCWESNSR----------- 1422

  Fly  1014 SSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDR 1078
                            .|||||...|..|:||..|:|::...:|                 |.| 
  Fly  1423 ----------------AIVMLTRCFEKGREKCDQYWPVDRVAMF-----------------YGD- 1453

  Fly  1079 YLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNV--GIVRRNG 1141
                  :...::..:...|:.||                         .|.:.:|.  .|:|   
  Fly  1454 ------IKVQLIIDTHYHDWSIS-------------------------EFMVSRNCESRIMR--- 1484

  Fly  1142 YSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFD 1206
                                        |:.:..|||...|....:|:                 
  Fly  1485 ----------------------------HFHFTTWPDFGVPEPPQSLV----------------- 1504

  Fly  1207 IYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSL 1271
                           :.:..::..|...::|: ::|||||:||:|.|.|:               
  Fly  1505 ---------------RFVRAFRDVIGTDMRPI-IVHCSAGVGRSGTFIAL--------------- 1538

  Fly  1272 TGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDV 1336
                                          .|.:.||  |:..                  :||:
  Fly  1539 ------------------------------DRILQHI--HKSD------------------YVDI 1553

  Fly  1337 LGIVCNLRLQRGGMVQNSEQYELIHRAICLYLK 1369
            .|||..:|.:|..|||..:||..||:.:...|:
  Fly  1554 FGIVFAMRKERVFMVQTEQQYVCIHQCLLAVLE 1586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 85/450 (19%)
PTPc 917..1364 CDD:238006 85/449 (19%)
Ptp4ENP_001162669.1 FN3 151..242 CDD:238020 17/62 (27%)
fn3 247..328 CDD:278470 14/88 (16%)
fn3 343..417 CDD:278470 18/77 (23%)
fn3 443..525 CDD:278470 14/82 (17%)
FN3 548..611 CDD:238020 12/72 (17%)
FN3 620..706 CDD:238020 16/117 (14%)
fn3 708..796 CDD:278470 13/89 (15%)
fn3 824..886 CDD:278470 8/63 (13%)
fn3 902..978 CDD:278470 18/90 (20%)
fn3 1013..1092 CDD:278470 18/84 (21%)
UP_III_II 1106..>1248 CDD:297589 19/143 (13%)
PTPc 1329..1582 CDD:214550 93/486 (19%)
PTPc 1355..1582 CDD:238006 85/450 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124031782
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19134
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.