DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and Ptpn20

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001073618.1 Gene:Ptpn20 RGDID:1309812 Length:421 Species:Rattus norvegicus

Alignment Length:589 Identity:120/590 (20%)
Similarity:189/590 (32%) Gaps:271/590 (46%)


  Fly   828 SYQTNRNIIEQPPVLGSN------ARDV-------ETPTDMVPPSSEDSELL--ASYQTVVS--- 874
            |:....:::...||...|      .||:       ....:...||...|.:|  :|..|.||   
  Rat    61 SFSNKYDLVFPEPVESDNDETLWDVRDLSHRNRWSSVDPESAGPSKTVSTVLSESSTDTAVSERE 125

  Fly   875 --RMAQPIPELKENEQKRIFR------------DLHKEFWDLPLNHQEKPMVFGS------QTKN 919
              ::||..|.:..:..:...|            |:.:||  |.|.....|..|.|      :.||
  Rat   126 LTQLAQIRPLIFNSSSRAALRDCLKALQKKEELDIIREF--LELEEMIPPDDFKSGYELQNRDKN 188

  Fly   920 RYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSK-CYVATQG 983
            ||:.|||.:::||.|                      .::..||||:||:..::..: .|:||||
  Rat   189 RYRDILPYDSTRVPL----------------------GKNKDYINASYIRIVNHEEEYFYIATQG 231

  Fly   984 PLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVY 1048
            |||:||.:||.|:.:|      .|                     ..|.|:|...|....||..|
  Rat   232 PLPDTIEDFWQMVLEN------NC---------------------NVIAMITREIEGGVIKCCSY 269

  Fly  1049 FPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVT 1113
            :|:.|.|                                         ..|....|:.:|:.::|
  Rat   270 WPVSLKE-----------------------------------------PLEFKHFHVLLENFQIT 293

  Fly  1114 LEGDLLEALPAQGSFFLIKNVGIVRRN---GYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPD 1175
                         .:|:|:...||:::   .:||:                |||.|        .
  Rat   294 -------------QYFVIRIFQIVKKSTGKSHSVK----------------HLQFI--------K 321

  Fly  1176 WPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV 1240
            ||||.:|...:..:....:|                   |.:|:..               || :
  Rat   322 WPDHGTPASADFFIKYVRYV-------------------RKSHITG---------------PL-L 351

  Fly  1241 IHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHI 1305
            :|||||:||||.|..:                                     |..| |...::.
  Rat   352 VHCSAGVGRTGVFICV-------------------------------------DVVF-CTIEKNY 378

  Fly  1306 SHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKR 1370
            |                           .:::.||..:|.||.||:|..|||:..:..:...|:.
  Rat   379 S---------------------------FNIMNIVTQMRKQRFGMIQTKEQYQFCYEIVLEVLQN 416

  Fly  1371 TLAL 1374
            .|||
  Rat   417 LLAL 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 90/452 (20%)
PTPc 917..1364 CDD:238006 90/451 (20%)
Ptpn20NP_001073618.1 PTPc 160..412 CDD:214550 97/481 (20%)
PTPc 186..412 CDD:238006 90/453 (20%)
Substrate binding. {ECO:0000250} 354..360 5/6 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.