DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and sre-45

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_496843.2 Gene:sre-45 WormBaseID:WBGene00010071 Length:369 Species:Caenorhabditis elegans

Alignment Length:119 Identity:23/120 (19%)
Similarity:40/120 (33%) Gaps:44/120 (37%)


  Fly   911 MVF--GSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDY 973
            |:|  |:.|.| |....|     :.:..::..|......::....|     |.:::..|:     
 Worm     1 MIFLIGNSTSN-YTVCFP-----IFILEDTRALKFPYSMLQALEFV-----LTFVSFYYV----- 49

  Fly   974 VSKCYVAT---------------------QGPLPNTIFE-----FWLMIYQNTQ 1001
            :..||||.                     :|.|.|.:.:     ||.:...|||
 Worm    50 IKCCYVAIHIKSFHRNLTVLLIILMIQWFEGLLSNILIKPYETGFWPLGEHNTQ 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 20/113 (18%)
PTPc 917..1364 CDD:238006 20/112 (18%)
sre-45NP_496843.2 Sre 1..369 CDD:251743 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.