DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and C46A5.1

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_501277.1 Gene:C46A5.1 WormBaseID:WBGene00016698 Length:497 Species:Caenorhabditis elegans

Alignment Length:677 Identity:111/678 (16%)
Similarity:216/678 (32%) Gaps:270/678 (40%)


  Fly   716 AANQAP----HQR----KFFSTENLNSSKANSQKFFGQVCFGSASDLQPNPQQDSVREDQAIGAT 772
            |.:|||    |:|    |...|.|..:.|.:.:|        |.|..:..|:.         |.:
 Worm     3 AVDQAPKKKSHERKRKEKRVHTGNGTAKKHHKRK--------SRSKSKNKPKN---------GLS 50

  Fly   773 CTCAGTVRNI---------------MTRPLSPQTTSEEFKIYLA-SIQMLQSASNPLN------- 814
            | |....:..               :.:||:|....:..::.|. ::::.::...|.|       
 Worm    51 C-CRKKKKKSKKSKSKVTKKQPKKKVIKPLAPVPNEQLGEVVLVKNVKLPETPQKPENDTPVKDG 114

  Fly   815 -----------QFDLIRLNYVFDHSYQTNRNIIEQPPVLGSNARDVETPTDMVPPSSEDSELLAS 868
                       :.:|.:.::...:....:.|..|:.    ...::|::|.|:     :|.....|
 Worm   115 LKPPRTTNSVEKINLSKESFNLSNEKIASDNGTEEK----MEKKNVDSPADI-----QDGLKGKS 170

  Fly   869 YQTVVSRMAQ---------------PIPELKENEQKRIFRDLHKEFWDLPLNHQEK------PMV 912
            .|....::.|               .|.:.|..:.|.:.::..|:..::.:|..||      |.:
 Worm   171 KQKSEEKVHQKAKDDAKRGDECNKFKISDEKLTKWKLVAQETLKDDANIAVNEFEKVSGYLPPHI 235

  Fly   913 -----FGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPD 972
                 ..:..|||:..::..::|||.|...|                       ||:||::....
 Worm   236 SKNHFVSNMDKNRFVDVICMDHSRVKLTDSS-----------------------YIHANWVDLNS 277

  Fly   973 YVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNF 1037
              ||..:.||.||.:|..:||.|                           |:.|..:.::::...
 Worm   278 --SKKAILTQLPLSHTASDFWQM---------------------------IIDQKIKCVLLIMTD 313

  Fly  1038 TEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISG 1102
            .|.|:......||                                        .:.|.:.:|  .
 Worm   314 GEFNKFGGNSVFP----------------------------------------QNQDFLKFE--D 336

  Fly  1103 RHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIY 1167
            |.|.|                  |.|   |.|.:.:  |::::.|          |.|....|.:
 Worm   337 RFIRV------------------GEF---KQVELGK--GWNLKVL----------SVSNGTYKTF 368

  Fly  1168 CYHYWYPDWPDHHSPRDINTLLDTCLHV-----------LNLGKC--ESEFDIYDDTRSERNAHL 1219
            .:.:.|.:||....|.|:..:.....::           :::..|  ...|.:::      .||:
 Worm   369 IHVHHYKNWPHGSIPSDVKQIWQVQSYLRKYTDGHPPVYMSMSGCGRAGTFALFE------TAHM 427

  Fly  1220 AAQRLEIYQQDIFNAVQPLPVIHCSAGI--GRTGCFTAILNAVRQLRQ-SLAYSLTG--MLTKSL 1279
            :          :.|....|.::.|...:  ||       |::|:.|.| |:.|:|..  :|...:
 Worm   428 S----------LHNEQPSLNMVKCLENVRNGR-------LHSVQNLSQFSVVYTLIAEHVLGNGI 475

  Fly  1280 TSSSTEEYHNPTDSDSSFTCNTIRHIS 1306
            .....||..|..|       |.:|.::
 Worm   476 GKKDVEEQENSID-------NILRQLT 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 70/410 (17%)
PTPc 917..1364 CDD:238006 70/409 (17%)
C46A5.1NP_501277.1 Y_phosphatase 243..468 CDD:278528 63/375 (17%)
PTPc 245..468 CDD:238006 63/373 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.