DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and C33H5.16

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_501293.3 Gene:C33H5.16 WormBaseID:WBGene00016382 Length:341 Species:Caenorhabditis elegans

Alignment Length:524 Identity:103/525 (20%)
Similarity:153/525 (29%) Gaps:247/525 (47%)


  Fly   861 EDSELLASYQTVVSRMAQPIPELKE-NEQKRIFRDLHK-EFWDLPLNHQEKPMVFGSQTKNRYKT 923
            :..:::...||.:.:  .||....| |..|| |.|..| :.:....:|.          |||||.
 Worm    32 QKKQIVQFVQTTLEK--GPIGLRNEFNAMKR-FNDFDKMQSFKKAQDHH----------KNRYKD 83

  Fly   924 ILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLP--YINANYIKGPDYVSKCYVATQGPLP 986
            :...:|:||.|                     |....|  ||:||::..|.. :|.::..|.||.
 Worm    84 VGCLDNNRVKL---------------------AHPPWPHDYIHANFVSTPAN-AKRFICAQAPLD 126

  Fly   987 NTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPI 1051
            ||..:||.|           |                ||:..:.|.||.|..|...:||:.|   
 Worm   127 NTCADFWYM-----------C----------------LQERVEAIFMLCNLMEKGAKKCSEY--- 161

  Fly  1052 ELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSD---AIDYEISGRHIGVESVKVT 1113
                 :|...|                       |:.|....|   .:.||.||....|:..|..
 Worm   162 -----YATKEK-----------------------PELVFHEKDQKITVKYEASGTVKFVKPTKAV 198

  Fly  1114 LEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPD 1178
            ::..:|                |:...|..|.|..                     ||.:.||||
 Worm   199 VKETVL----------------IIEGPGGQVLKTT---------------------HYHWIDWPD 226

  Fly  1179 HH-SPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPL--PV 1240
            .. .|.|::.:                                         ::....:||  |:
 Worm   227 RGVPPADLSII-----------------------------------------ELLIKARPLKGPI 250

  Fly  1241 -IHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRH 1304
             :||||||||||....|.....||               |..:..||    ||.           
 Worm   251 AVHCSAGIGRTGSVVMIEYMCEQL---------------LNGNQIEE----TDK----------- 285

  Fly  1305 ISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAIC-LYL 1368
                                              |:..:|.||...:|...||..:|:.:. .:|
 Worm   286 ----------------------------------ILQKIREQRNNSIQTDHQYLFVHQVMMNFFL 316

  Fly  1369 KRTL 1372
            ::.|
 Worm   317 EKKL 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 89/457 (19%)
PTPc 917..1364 CDD:238006 89/456 (20%)
C33H5.16NP_501293.3 Y_phosphatase 76..313 CDD:278528 90/469 (19%)
PTPc 77..313 CDD:238006 89/468 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.