DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and K07F5.6

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_501764.2 Gene:K07F5.6 WormBaseID:WBGene00010634 Length:470 Species:Caenorhabditis elegans

Alignment Length:461 Identity:94/462 (20%)
Similarity:149/462 (32%) Gaps:164/462 (35%)


  Fly   915 SQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYV 979
            |.:|||.|....|:|:||:|..|::|           :|.|...| .||||::||. |...|.::
 Worm   135 SLSKNRSKNHKLNDNTRVILSPENTE-----------NSRTDPPD-TYINASHIKF-DNSQKEFI 186

  Fly   980 ATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQK 1044
            .||.|||:|:.:||.|:      .|.:.....:...|..|  :.::::....:.|......:...
 Worm   187 VTQYPLPDTVRDFWRMV------SIMKVTQIVTIFEPQTD--EAIEEFRNPTLTLAAPAPTSTMT 243

  Fly  1045 CAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVE- 1108
            ....||:.:.:|             |..||                        :|.|:.|..| 
 Worm   244 TIGGFPVPIGQI-------------AHNRD------------------------QIQGQSIRCES 271

  Fly  1109 ----SVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIY-C 1168
                |....||.|  ..:..:|.....:.|.:..||...:.|..:.........|::  .|:| |
 Worm   272 NVHRSSFFPLETD--HYMNLKGWLINTRRVTVDHRNKGWMNKYTVEVVAEGCSEATF--AKVYNC 332

  Fly  1169 YHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFN 1233
            ..:.:..:||...            .||.|.:..     |.||.:...|:|             .
 Worm   333 TTWPWKKYPDDEK------------KVLALVRAP-----YKDTSTSLIANL-------------E 367

  Fly  1234 AVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFT 1298
            .:.|: |:.|..|:.|:.  |.:|.::                                      
 Worm   368 KLAPI-VVMCDLGLDRSA--TVVLTSI-------------------------------------- 391

  Fly  1299 CNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRA 1363
                     |:|  ...|.|||.......||.|              ||.|:...|..|....||
 Worm   392 ---------IID--QIIAGKTPDCDALFKKMRD--------------QRAGVFTMSIFYTYAIRA 431

  Fly  1364 ICLYLK 1369
            ...|:|
 Worm   432 ALFYMK 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 91/454 (20%)
PTPc 917..1364 CDD:238006 91/453 (20%)
K07F5.6NP_501764.2 eIF1_SUI1_like <30..>110 CDD:294159
PTPc 111..434 CDD:214550 92/457 (20%)
PTPc 138..433 CDD:304379 91/453 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.