DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and M05D6.3

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_495789.1 Gene:M05D6.3 WormBaseID:WBGene00010876 Length:397 Species:Caenorhabditis elegans

Alignment Length:299 Identity:60/300 (20%)
Similarity:99/300 (33%) Gaps:93/300 (31%)


  Fly   851 TPTDMVPPSSEDSEL----------LASYQTVVSRMAQPIPELKENEQKR--------------- 890
            ||||.:......|.|          ||..::..::......|.||.|..:               
 Worm     2 TPTDFMRSFISQSWLEDEIEGSIRQLAGTESQTTQTGGETAEGKEEEVNKNVTPEEAFKAVTVEG 66

  Fly   891 --IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSS 953
              :...:|......| |..:|  ...:...||...:...::|||.|..:..:             
 Worm    67 PELLNQMHTSAMTYP-NTYDK--FLNNMDMNRIPHLYCFDHSRVELAPQDGK------------- 115

  Fly   954 VTASEDLPYINANYIKGPDYVSK-CYVATQGPL-PNTIFEFWLMIYQNTQRYIRRCVDGGSSSSP 1016
                :|  :.||:::.|  |..| .|:..|.|. .:|.:.||.|:.:.....|....|       
 Worm   116 ----DD--FYNASWVDG--YSKKSAYIFAQAPFNDHTEYIFWRMVSERKPSMILVFGD------- 165

  Fly  1017 HVDREQ-------ILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARD 1074
             :|.:|       |..:.|:| ..|..|...:.::|      ||.     |..|..|.....::.
 Worm   166 -IDEKQKRKAPYDISDRGFEK-SFLHEFGAKSLEEC------ELK-----AKICRKFWPEKRSKK 217

  Fly  1075 YFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVT 1113
            .|     ||.   ::.||.|.     |..|:...::.||
 Worm   218 DF-----PTL---SIQASDDH-----SETHMKTFNLTVT 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 44/208 (21%)
PTPc 917..1364 CDD:238006 44/207 (21%)
M05D6.3NP_495789.1 PTPc 83..356 CDD:214550 45/218 (21%)
PTPc 94..344 CDD:304379 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.