DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and F25H5.7

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_492454.1 Gene:F25H5.7 WormBaseID:WBGene00009129 Length:490 Species:Caenorhabditis elegans

Alignment Length:684 Identity:125/685 (18%)
Similarity:203/685 (30%) Gaps:311/685 (45%)


  Fly   611 NHSITLKTGHTTTSCGDLNSMQQLQQQQAMLSAEKYNRLNMRTNSTGSGSGSGSNVPTPKRGLLE 675
            |.|:.|.:|:...||                 |.|.|:...:|.:..|.......:...|    :
 Worm    12 NTSLLLASGYALWSC-----------------ASKKNKKETKTETKKSHDCPPQTIEPVK----D 55

  Fly   676 RRGSNQSLTLNMGSILGGAAGTEIQMTDIVQPKVTVCSCAAANQAPHQRKFFSTENLNSSKANSQ 740
            .:.||..                       :.|.|    ::.|:.|.|:|....:.:...|..|:
 Worm    56 EKNSNSE-----------------------EKKTT----SSNNEVPPQKKLIGNDEVKKEKKKSE 93

  Fly   741 KFFGQVCFGSASDL-----QPNPQQDSVREDQAIGATCTCAGTVRNIMTRPLSPQTTSEEFKIYL 800
                       .||     ..:.:.|..|.|             :...::.||.:...||.|   
 Worm    94 -----------DDLLDVKKTASKEDDKKRMD-------------KKDPSKKLSKEKLREEKK--- 131

  Fly   801 ASIQMLQSASNPLNQFDLIRLNYVFDHSYQTNRNIIEQPPVLGSNARDVETPTDMVPPSSEDSEL 865
                   ..|..:|:...:..:...|...       ||||..||:.|.:                
 Worm   132 -------EQSKKVNKEKKMNKSESVDEDN-------EQPPEPGSDPRKI---------------- 166

  Fly   866 LASYQTVVSRM-AQPIPELKENEQKRIFRDLHKEFWDLPLN-----HQEKPMVFGSQTKNRYKTI 924
               :....::| .|.|.:|.:::.|..          :|.|     :...|.:      |||..:
 Worm   167 ---WAFKAAKMKCQAISKLHQDKIKGY----------MPPNCTYTAYDANPDL------NRYADV 212

  Fly   925 LPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTI 989
            ...|.:||:|:                     :.|..||:|::::.|......|:.||||||.|:
 Worm   213 RCIEETRVVLK---------------------NHDRDYIHASWMRMPGKDQSTYITTQGPLPETL 256

  Fly   990 FEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELN 1054
            .:||.||||....|                           ::||....|...:|||:|:|.:|.
 Worm   257 SDFWHMIYQEKIAY---------------------------VLMLCTLFEGGVEKCALYYPEKLG 294

  Fly  1055 EIFAVAAKCEVFQLSAAARDYFDRY-LTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDL 1118
            |:..                 |.:| :|.|...:..:|                        |.:
 Worm   295 EVVK-----------------FGKYEITLTECKEEAIA------------------------GTI 318

  Fly  1119 LEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPR 1183
            ..||....:                             :.||  .:.:|..|...|.|||..:|.
 Worm   319 WNALTVTNT-----------------------------EDAS--SEPLYMNHVQVPWWPDQLAPE 352

  Fly  1184 DINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQP--LPV-IHCSA 1245
            |                                   |...:|:|:.  ...|.|  .|: :||||
 Worm   353 D-----------------------------------ARPMIELYKW--VKKVNPKETPICVHCSA 380

  Fly  1246 GIGRTGCFTAI---------------LNAVRQLR 1264
            |:|||..|..|               |:.||::|
 Worm   381 GVGRTATFVGIDYATIRIMENPNIEMLDIVREMR 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 75/369 (20%)
PTPc 917..1364 CDD:238006 75/368 (20%)
F25H5.7NP_492454.1 PTPc 192..436 CDD:214550 78/387 (20%)
PTPc 205..436 CDD:238006 75/374 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.