DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and F47B3.7

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_491276.1 Gene:F47B3.7 WormBaseID:WBGene00018531 Length:374 Species:Caenorhabditis elegans

Alignment Length:545 Identity:114/546 (21%)
Similarity:166/546 (30%) Gaps:254/546 (47%)


  Fly   840 PVLGSNARDVET----PTDMVPPSSEDSELLASYQTVVSRMAQPI--PELKENEQKRIFRDLHKE 898
            |:|.....|..:    |..:|.|::..|.          ||...|  |.:.....|.:.: |..|
 Worm    18 PILSRENSDTSSERDYPESIVWPNTAQSR----------RMHVSIVRPWVHHTLNKGVSK-LRDE 71

  Fly   899 FWDLPLNHQEKPM-VFGSQ-TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLP 961
            |.::...:...|: .|.|. .||||..|...|.:||:|.::.                 ||.|  
 Worm    72 FSEVANKNPNVPVDAFKSNPEKNRYTDIKCIEKTRVILTTDG-----------------ASSD-- 117

  Fly   962 YINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQ 1026
            ||:|||: |.....|.::.||||..:||::||.|                           ::|.
 Worm   118 YIHANYV-GISIKPKKFICTQGPKDSTIYDFWAM---------------------------VIQD 154

  Fly  1027 YFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVA 1091
            ..:.|:||....|..|.||..|:|       ||..:                  |.|:|.     
 Worm   155 NVESIIMLCKVIELARVKCEQYWP-------AVEGQ------------------TNTYVS----- 189

  Fly  1092 SSDAIDYEISGRHIGVESVKV-TLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRV 1155
                     .|..|.:.::.| ||..|        ..|..:.|:.:|...  ..|.:.       
 Worm   190 ---------KGHTITINNLGVGTLSPD--------DDFINVTNLELVWAG--KTRSIT------- 228

  Fly  1156 PQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLA 1220
                          ||.:.:||||.:|            .:|:|                    |
 Worm   229 --------------HYQWTNWPDHGAP------------PINMG--------------------A 247

  Fly  1221 AQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTE 1285
            ...:|....|    ..|: |:|||||:||:|                                  
 Worm   248 INLIEAVNYD----TNPV-VVHCSAGVGRSG---------------------------------- 273

  Fly  1286 EYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVC--------N 1342
                           ||..||.|:|                 ||      :.||.|        .
 Worm   274 ---------------TIVGISLIMD-----------------KM------IQGINCKDMKKLVEE 300

  Fly  1343 LRLQRGGMVQNSEQYELIHRAICLY 1367
            :|.||...:|...||..|||.:..|
 Worm   301 IRNQRHYAIQTEAQYMYIHRVLLEY 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 95/458 (21%)
PTPc 917..1364 CDD:238006 95/456 (21%)
F47B3.7NP_491276.1 Y_phosphatase 90..324 CDD:278528 95/460 (21%)
PTPc 92..324 CDD:238006 95/458 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.