DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTP-ER and Y48G1C.5

Sequence 1:NP_726092.1 Gene:PTP-ER FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_490668.4 Gene:Y48G1C.5 WormBaseID:WBGene00021678 Length:1161 Species:Caenorhabditis elegans

Alignment Length:1231 Identity:218/1232 (18%)
Similarity:373/1232 (30%) Gaps:494/1232 (40%)


  Fly   200 PKLLSSINN-LNVSGSPLNIINSA-----GYKNGN-----FFRFPEIDHV--------VQDAPMD 245
            ||..|::|: |..|...|||:.:.     |:||.|     |..:|::..|        :.|....
 Worm   193 PKSHSALNDLLKKSQDFLNIVENPKITLHGFKNNNSAASFFVLWPKVRDVMNFISSFKIVDINRG 257

  Fly   246 TVCLEE--ATRRDRSPALAEPPEQQQQKSEGRKNRKNKNNLTI--RITDVPIKNSSQPSPLPKPK 306
            ...|||  |:.|:..|........|..:|.|:..|..|..:.:  ...|:...||...:.....:
 Worm   258 LRKLEEHMASIRNAFPNQESKIHLQTIESIGQSLRTKKYTVGLPNGAIDIGALNSQLATDAWARE 322

  Fly   307 T----------PTIKSTKEKARSLDSAANESELSIVVHNITESHGSCDDMETGQSQPSTSVIHHH 361
            |          .||....|:.|:::....:...|.:                  ||...::  ..
 Worm   323 TTDHMIFLRELETIWLLGEEVRNVERLLRKDRFSTI------------------SQLFNTI--ER 367

  Fly   362 LHLQQPASAIHSTSLSRL-DSHLSLANQRRTPRRKSPGINTTDWLMYHRKQNPYQVQPTHCSSTT 425
            |.:|         ||:.| |....:|...::....:|.....:.|                 |..
 Worm   368 LDIQ---------SLNVLVDEAKVIAQCAKSTLTTAPDFTNLEEL-----------------SKI 406

  Fly   426 QSSLDSDASLTPSLGDFELKSACSVDGGSKFGIGASLAPRSAHKHNQLLHSSSTNLKTLPECLTL 490
            .|::|::...:.|:    |||..                      |||:.|.|.:.:.|..|   
 Worm   407 ASNIDTELEQSKSI----LKSVM----------------------NQLVESKSGHAEVLTVC--- 442

  Fly   491 VEFSSSGGGPKESPF----KQKSMDLPMPTLQAKTT-VSTSSMNLLQRRG--------SNHSLTL 542
            .:.::|.....|..|    |...:.|.|..:.|..| ::.:.:..|::|.        |:.:..|
 Worm   443 KDMNNSNWTTAEPCFNGVKKMTGLSLTMSRMTANATFLNPNLLKTLEKRAIEKINDSRSDIAQFL 507

  Fly   543 NLHSSCGNLMNSGLSHSNYSLGSILNSKSSCNLDAGTASQIRADQ------------LPQSHLLG 595
            :: .||        ..||..|..|..:.|..|       ..||||            |.....|.
 Worm   508 DV-LSC--------LQSNKELDKIQKNLSDLN-------SFRADQKFPPIVTAVEDALISVSSLN 556

  Fly   596 SSQGSRQGLFRRRGSNHSITLKTGHTTTSCGDLNSMQQLQQQQAMLSAEKYNRLNMRTNSTGSG- 659
            |...|....|.:|....|.  ||.....:....||:....|:.|.|......|.|:......:. 
 Worm   557 SGLKSLALYFSKRRKFASD--KTSQFPNAAEHTNSIGPAAQEIARLEDVLRERANVDIIKNHAQI 619

  Fly   660 -----SGSGSNVPTPKRGLLER----------------------RGSNQSLTLNMGSI------- 690
                 :.||:.:....:..||:                      :.|:.:..::.|.:       
 Worm   620 VQRELAASGATLAQDDKDNLEKLVALGASLDVMFVQLDAWKSGIKKSDSTKFVDYGYVFTEAKKV 684

  Fly   691 ----LGGAAGTEIQMTDIVQPKVTVCSCAAANQAPHQRKFFSTENLNSSKANSQKFFGQVCFGSA 751
                |||..|.|..:..:|:....|                          .::|..|:|     
 Worm   685 DWANLGGLMGLEKSLEKLVELVKDV--------------------------GNKKSLGEV----- 718

  Fly   752 SDLQPNPQQDSVREDQAIGATCTCAGTVRNIMTRPLSPQTTSEEFKIYLASIQMLQSASNPLNQF 816
                    ||:::                           :.::..:..:|.|         |:.
 Worm   719 --------QDALK---------------------------SLDDGGLEFSSFQ---------NRL 739

  Fly   817 D-----LIRLNYVFDHSYQTNRNIIEQPPVLGSNARDVETPTDMVPPSSEDSELLASYQTVVSRM 876
            |     |..|:..|.:.::.....|..||.||::.::..      ||.:....::.:...:|   
 Worm   740 DEPKKALAALDLFFSNLFKPLPTAILPPPDLGNSEKNGP------PPQTHGQYVILALIVIV--- 795

  Fly   877 AQPIPELKENEQKRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNEN-SRV-------- 932
                          |...:...|...|..::    :..|:.|.  |...||:. |||        
 Worm   796 --------------IICAIIAYFCLTPNGYK----ILDSEEKE--KLYPPNQMISRVDVNETRFS 840

  Fly   933 -LLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQG-------PLPNTI 989
             .|::.:::::..:...:..:||  .|::|  |...|.|.|:...|  ..||       |:.   
 Worm   841 NFLKTFNTQISDFVTRKRNCTSV--FENVP--NNLEITGDDFAQFC--GLQGGNHCQCDPVS--- 896

  Fly   990 FEFWLMIYQNTQRYIRRCVDGGSSSSPH-------------------VDR------------EQI 1023
                   |:::::       .|...|.|                   ||:            |.:
 Worm   897 -------YESSKK-------NGQGESSHVVELDNGLKFVLMPAPQLPVDKKSSDILAIAAFWESV 947

  Fly  1024 LQQYFQKIVMLTNFTE------ANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTP 1082
            .......||||.:|.|      ||:..|..|||.||:|...:|                      
 Worm   948 KLNKPSTIVMLCDFAEIDHFIGANKVNCDRYFPTELDEKLILA---------------------- 990

  Fly  1083 TFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKL 1147
                |..:..:.:|                              |..|:|           .|:|
 Worm   991 ----DLTITCTKSI------------------------------SKPLLK-----------TRQL 1010

  Fly  1148 VLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTR 1212
            :|.:..:..|..:         ||.|..||:|..|:|...:    .::|.|           .|.
 Worm  1011 LLTFGKKRTQEVT---------HYQYTGWPEHMGPKDAEEI----RYLLKL-----------VTD 1051

  Fly  1213 SERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTG 1273
            |||                     |:.|: |:.|.||:..|..|    ..|.|::..|.||
 Worm  1052 SER---------------------PVFVV-CNTGGGRSAAFVLI----ESLFQAINTSETG 1086

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 79/413 (19%)
PTPc 917..1364 CDD:238006 79/412 (19%)
Y48G1C.5NP_490668.4 WSN 47..111 CDD:280385
PTPc <940..1085 CDD:304379 51/262 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.