DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15673 and AgaP_AGAP005241

DIOPT Version :9

Sequence 1:NP_611591.3 Gene:CG15673 / 37459 FlyBaseID:FBgn0034639 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_314145.4 Gene:AgaP_AGAP005241 / 1274948 VectorBaseID:AGAP005241 Length:248 Species:Anopheles gambiae


Alignment Length:168 Identity:60/168 - (35%)
Similarity:87/168 - (51%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IMIGVIIAS--SCCVDGQSYLFSVENVLHESARPLPYNLTNANGT-TEVELF-PDTISNNTRIIV 64
            :||.:.:|.  .|..|.......:..|......|......:...| ||.:|: .||.:...:.| 
Mosquito    13 VMIALFVAGKVQCLPDRVEPAGQLTTVPERVDGPTESTTDDVAATVTEDDLYLVDTTTTTQQSI- 76

  Fly    65 YKNTVVESPNDLSQTAMDVITIVWYVATFLALAAFFMLMACSD-RRCRDMRRRPAGGQSTEGLRA 128
             |.|..:.........||.||||||:|||:||.:||::|||:| .|||.  |:|    |:..|..
Mosquito    77 -KTTTHDRVLFTDTPVMDAITIVWYLATFIALISFFLVMACADHNRCRS--RKP----SSSELTP 134

  Fly   129 PPTPSPSYSEFAPPSYDTVIKMQHAAKTSVFVIPFSNK 166
            ||||:|||..|||||||:::..:.  ..|:|:||:..:
Mosquito   135 PPTPAPSYHHFAPPSYDSLVFEKD--NDSIFIIPYDTR 170



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019727
OrthoInspector 1 1.000 - - oto108586
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X15274
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.