DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd4

DIOPT Version :10

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001121426.1 Gene:kctd4 / 100158517 XenbaseID:XB-GENE-967658 Length:257 Species:Xenopus tropicalis


Alignment Length:105 Identity:46/105 - (43%)
Similarity:66/105 - (62%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 TAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQI--PIVLDSLKQHYFIDRDGGMFRHILNFM 196
            |:.|.::|||.:|.:..:||:|||:|.|..:.|.:|  ||..|.   ||||||||.:|||:|||:
 Frog    30 TSLVTLNVGGYLYITQKQTLSKYPDSYLEGVVNRKIFCPIDADG---HYFIDRDGLLFRHVLNFL 91

  Fly   197 RNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDR 236
            ||..||:.|.|.:..||..||.:::    :|.|.:..|.|
 Frog    92 RNGELLLPEGFKENHLLAHEADFFK----LKALNAAVKAR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 42/94 (45%)
kctd4NP_001121426.1 BTB_POZ_KCTD4 32..117 CDD:349673 41/91 (45%)
KCTD4_C 136..257 CDD:437155
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.