DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and GCD11

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_010942.1 Gene:GCD11 SGDID:S000000827 Length:527 Species:Saccharomyces cerevisiae

Alignment Length:463 Identity:106/464 (23%)
Similarity:183/464 (39%) Gaps:116/464 (25%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLV-----------DAPA 59
            |||.:|||..||:|:.:|:|.:.:....|:    :||.||:.||::...:           |...
Yeast   102 NIGTIGHVAHGKSTVVRAISGVQTVRFKDE----LERNITIKLGYANAKIYKCQEPTCPEPDCYR 162

  Fly    60 HLPQGEQL-----------------QFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-KQT 106
            .....:::                 ..:|||||||..|:.|::.||.::|..||::...:. .|.
Yeast   163 SFKSDKEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQP 227

  Fly   107 QTAECLIIGELLQKKLIVVI-NKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQ 170
            ||:|.|...|:::.|.:::: ||:|:..|.   |.||..: .:.|.:..|...| .||..:||..
Yeast   228 QTSEHLAAIEIMKLKHVIILQNKVDLMREE---SALEHQK-SILKFIRGTIADG-APIVPISAQL 287

  Fly   171 GTHIAELREVLREAYFQPQRNLADPLFMYVDHCFGIKG--------QGTVCTGTLLQGKVQVNNV 227
            ..:|..:.|.:.:....|.|:......:.|...|.:..        :|.|..|::|.|..::.:.
Yeast   288 KYNIDAVNEFIVKTIPVPPRDFMISPRLIVIRSFDVNKPGAEIEDLKGGVAGGSILNGVFKLGDE 352

  Fly   228 IEL-PAL---GEQRKVKSIQMFRKNVTS----------ASMGDRIG--------LCVTQFNAKLL 270
            ||: |.:   .::.|::...:| .|:.|          |..|..||        ||    .|..|
Yeast   353 IEIRPGIVTKDDKGKIQCKPIF-SNIVSLFAEQNDLKFAVPGGLIGVGTKVDPTLC----RADRL 412

  Fly   271 ERGIITQPGYLKPIYAVCLQFKPIRYY--------KEVIKSMRKMHISVGHNTVMANVTLFRDTD 327
            ...::...|:|..||...    .|.|:        |...:...|:.....:..:|.|:       
Yeast   413 VGQVVGAKGHLPNIYTDI----EINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNI------- 466

  Fly   328 GTTSTFQLDKEYEYMEDVQPAEVQHNDVIYALLQFESPVLSPPHSTLIASKLDMDVHSTSCRLAF 392
            |:|:|              .|.|.......|.||..||..:..:..:..|: .::.|        
Yeast   467 GSTAT--------------GARVVAVKADMARLQLTSPACTEINEKIALSR-RIEKH-------- 508

  Fly   393 WGRIAWQT 400
            |..|.|.|
Yeast   509 WRLIGWAT 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 58/216 (27%)
SelB 6..467 CDD:225815 106/464 (23%)
SelB_II 196..278 CDD:293897 22/112 (20%)
eSelB_III 283..396 CDD:294009 21/121 (17%)
GCD11NP_010942.1 PTZ00327 74..524 CDD:240362 106/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3276
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.