DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and Eefsec

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_075547.1 Gene:Eefsec MGIID:2137092 Length:583 Species:Mus musculus

Alignment Length:577 Identity:247/578 (43%)
Similarity:339/578 (59%) Gaps:69/578 (12%)


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLVDAPAHLPQGEQ- 66
            :|.|:|:|||:|||||.||:|||:.:|||||||.|||.|||||||||||..:|..|...|.... 
Mouse     6 VNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFVVPLPGAEPGSSDT 70

  Fly    67 -LQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQKKLIVVINKID 130
             ||.|.|||||||||||||||||||||||:||:|..||.|||:||||:||::..:||:||:||||
Mouse    71 LLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIGQIACQKLVVVLNKID 135

  Fly   131 VYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQG----------THIAELREVLREAY 185
            :..|.:|.:.::|:..::.||||.|.|.| .||..|:|..|          ..|:||.|:|:...
Mouse   136 LLAEGKRQAAIDKMTKKMQKTLENTKFRG-APIIPVAAKPGGPEAPETEAPQGISELIELLKSQI 199

  Fly   186 FQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVT 250
            ..|.|:.:.|..|.|||||.|||||||.|||:|.|.:.:.:.:|:|||...:||||:|||...||
Mouse   200 SIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGTISLGDSVEIPALKVVKKVKSMQMFHTPVT 264

  Fly   251 SASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHNT 315
            ||..|||:|:|||||:.||||||::..|..|..::|..:..:.|.|::..:::..|.||:|||.|
Mouse   265 SAMQGDRLGICVTQFDPKLLERGLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHET 329

  Fly   316 VMANVTLFR------DTDGTTSTFQLDKEYEYME-----DVQPAEVQHNDVI------------- 356
            ||.....|.      |.:....:|.|.:||.:.|     |..|...:.:|..             
Mouse   330 VMGRTLFFSPAPDSFDLEPVLDSFDLSREYLFQEQYLCKDSMPTATEGDDEADPKAGHAPGGHCP 394

  Fly   357 ---YALLQFESPVLSPPHSTLIASKLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEELPKLRIFKR 418
               :||::||.||..|....:|.|:||.|:|:.:|||||.|.:........|.:..||.||::|.
Mouse   395 RQQWALVEFEKPVTCPRLCLVIGSRLDADIHTNTCRLAFHGVLLQGLEDKNYIESFLPALRVYKL 459

  Fly   419 KQKVGSIQRVVNSSEVIVQNLF-KDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAITFQDALS 482
            |.|.|.::||::...||.::|| |:....|:||..|:|||||:|.|:..|||:.|..|.....||
Mouse   460 KHKHGLVERVMDDYSVIGRSLFKKETNIQLFVGLKVQLSTGEQGIIDSAFGQSGKFKIHIPGGLS 524

  Fly   483 PE-------TISN---------------------VKNVKVLLNCKKYVFNKQAGLFQ 511
            ||       |:..                     ::.|.:.|:.|:|||:.|..:.|
Mouse   525 PESKKILTPTLKKRSRAGRGETTKPEEGTERPEPIQPVTLNLSFKRYVFDTQKRMVQ 581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 109/199 (55%)
SelB 6..467 CDD:225815 228/501 (46%)
SelB_II 196..278 CDD:293897 48/82 (59%)
eSelB_III 283..396 CDD:294009 41/140 (29%)
EefsecNP_075547.1 SelB_euk 8..197 CDD:206676 107/190 (56%)
GTP_EFTU 8..195 CDD:278438 106/188 (56%)
G1. {ECO:0000255|PROSITE-ProRule:PRU01059} 14..21 6/7 (86%)
G2. {ECO:0000255|PROSITE-ProRule:PRU01059} 46..50 4/4 (100%)
G3. {ECO:0000255|PROSITE-ProRule:PRU01059} 78..81 3/3 (100%)
G4. {ECO:0000255|PROSITE-ProRule:PRU01059} 132..135 3/3 (100%)
G5. {ECO:0000255|PROSITE-ProRule:PRU01059} 171..173 1/2 (50%)
SelB_II 210..292 CDD:293897 48/82 (59%)
eSelB_III 297..437 CDD:294009 41/140 (29%)
Nuclear localization signal. {ECO:0000255} 534..540 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162195983
eggNOG 1 0.900 E1_COG3276
Hieranoid 1 1.000
Homologene 1 1.000 H11073
Inparanoid 1 1.050 427 1.000 Inparanoid score I1720
Isobase 1 0.950 0 Normalized mean entropy S2647
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006109
OrthoInspector 1 1.000 T1085506
orthoMCL 1 0.900 OOG5_130322
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3582
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.