DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and eefsec

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001032513.1 Gene:eefsec ZFINID:ZDB-GENE-051120-72 Length:576 Species:Danio rerio

Alignment Length:569 Identity:260/570 (46%)
Similarity:351/570 (62%) Gaps:61/570 (11%)


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLVDAPAHL------ 61
            :|||:|:|||||||||:||:||||.:|||||||||||.|||||||||||...|..|.||      
Zfish     8 LNFNVGVLGHVDSGKTSLARALSSTASTAAFDKNPQSKERGITLDLGFSAFTVPLPEHLRESCGE 72

  Fly    62 PQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQKKLIVVI 126
            .|.:.||||.|||||||||||||||||||||||:||||..||.||||||||:||:|...:::|::
Zfish    73 KQYDSLQFTLVDCPGHASLIRTIIGGAQIIDLMMLVVDVVKGMQTQTAECLLIGQLTCSRMVVIL 137

  Fly   127 NKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQG----------THIAELREVL 181
            ||.|:.|.::|.:.::|:..|:.||||.|.| ...||.||:|..|          ..|.||.::|
Zfish   138 NKTDLLPSDKRQAAIDKMTKRMHKTLENTRF-KDCPIIAVAAKPGGPEAPDTDEPQGITELIDLL 201

  Fly   182 REAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFR 246
            :...|.|.|:.:..|.|.|||||.|:|||||.|||:|||.:.||:.:|:|||...|||||:||||
Zfish   202 KAQSFLPHRDPSGSLLMAVDHCFSIRGQGTVITGTILQGSLSVNDNVEIPALKVTRKVKSVQMFR 266

  Fly   247 KNVTSASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISV 311
            |.|.||..|||:|:|||||:.||||||::..||.|:.:||..:..:.|.||:..:.|..|.||:|
Zfish   267 KPVASAMQGDRVGVCVTQFDPKLLERGVVCTPGSLQTLYAAIISVQKIEYYRGALNSRAKFHITV 331

  Fly   312 GHNTVMANVTLFR---------DTDGTT-----STFQLDKEYEYMEDVQPAEVQ---HNDVIYAL 359
            ||.||||.::.|.         |:..|:     ::|..|.|:.::::...::.:   .....:||
Zfish   332 GHETVMARISFFNRVLPANENGDSKPTSQEQSANSFSFDWEFHHLDEHLTSQAEGGKGEPQQWAL 396

  Fly   360 LQFESPVLSPPHSTLIASKLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEELPKLRIFKRKQKVGS 424
            |:||.||..||...:|.|:||.|:|..:|||||.|::........|.:..||:|:|.|.|||.|:
Zfish   397 LEFERPVTCPPLCLVIGSRLDSDIHGNTCRLAFHGKLLEGFEDKNYTETALPRLKISKDKQKEGA 461

  Fly   425 IQRVVNSSEVIVQNLF-KDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAITFQDALSPETIS- 487
            ::||.:...||.:||| |:....|:||..|.|||||.|.||..|||:.|:.|...:.|..||.. 
Zfish   462 VERVTDDYTVIGRNLFKKETNLQLFVGLKVTLSTGEAGSIEGGFGQSGKIKIRIPEGLKEETKQL 526

  Fly   488 -------------------------NVKNVKVLLNCKKYVFNKQAGLFQ 511
                                     :.:.|.:.||.|:|:::....:.|
Zfish   527 LSSSSKKKGKGGSKNESPKLEEAKPDAQPVTIHLNFKRYIYDPHKKMVQ 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 116/203 (57%)
SelB 6..467 CDD:225815 244/495 (49%)
SelB_II 196..278 CDD:293897 53/82 (65%)
eSelB_III 283..396 CDD:294009 43/130 (33%)
eefsecNP_001032513.1 SelB_euk 10..202 CDD:206676 113/193 (59%)
GTP_EFTU 11..201 CDD:278438 111/191 (58%)
SelB_II 216..298 CDD:293897 53/82 (65%)
eSelB_III 303..433 CDD:294009 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162195485
eggNOG 1 0.900 E1_COG3276
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11073
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D370293at33208
OrthoFinder 1 1.000 FOG0006109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130322
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.