DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and EEFSEC

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_024309460.1 Gene:EEFSEC HGNCID:24614 Length:647 Species:Homo sapiens

Alignment Length:642 Identity:250/643 (39%)
Similarity:340/643 (53%) Gaps:135/643 (21%)


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLVDAPAHL------ 61
            :|.|:|:|||:|||||.||:|||:.:|||||||.|||.|||||||||||...|..||.|      
Human     6 VNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFSVPLPARLRSSLPE 70

  Fly    62 ----PQGEQ------LQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGE 116
                |:.|.      ||.|.|||||||||||||||||||||||:||:|..||.|||:||||:||:
Human    71 FQAAPEAEPEPGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIGQ 135

  Fly   117 LLQKKLIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQG---------- 171
            :..:||:||:||||:.||.:|.:.::|:..::.||||.|.|.| .||..|:|..|          
Human   136 IACQKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRG-APIIPVAAKPGGPEAPETEAP 199

  Fly   172 THIAELREVLREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPAL--- 233
            ..|.||.|:|......|.|:.:.|..|.|||||.|||||||.|||:|.|.:.:.:.:|:|||   
Human   200 QGIPELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGSISLGDSVEIPALKKN 264

  Fly   234 ---------------------------------GEQ---------------RKVKSIQMFRKNVT 250
                                             |.|               :||||:|||...:|
Human   265 SETWRVGPWPCFAGGPRPCAFSVVPALVQKSVPGPQTPLGWSSRCLQVVVVKKVKSMQMFHMPIT 329

  Fly   251 SASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHNT 315
            ||..|||:|:|||||:.||||||::..|..|..::|..:..:.|.|::..:::..|.||:|||.|
Human   330 SAMQGDRLGICVTQFDPKLLERGLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHET 394

  Fly   316 VMANVTLFR------DTDGTTSTFQLDKEYEYME-----DVQPAEVQHNDVI------------- 356
            ||..:..|.      |.:....:|...:||.:.|     |:.|| |..||..             
Human   395 VMGRLMFFSPAPDNFDQEPILDSFNFSQEYLFQEQYLSKDLTPA-VTDNDEADKKAGQATEGHCP 458

  Fly   357 ---YALLQFESPVLSPPHSTLIASKLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEELPKLRIFKR 418
               :||::||.||..|....:|.|:||.|:|:.:|||||.|.:........|....||:|:::|.
Human   459 RQQWALVEFEKPVTCPRLCLVIGSRLDADIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKL 523

  Fly   419 KQKVGSIQRVVNSSEVIVQNLF-KDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAITFQDALS 482
            |.|.|.::|.::...||.::|| |:....|:||..|.|||||.|.|:..|||:.|..|.....||
Human   524 KHKHGLVERAMDDYSVIGRSLFKKETNIQLFVGLKVHLSTGELGIIDSAFGQSGKFKIHIPGGLS 588

  Fly   483 PETISNV----------------------------KNVKVLLNCKKYVFNKQAGLFQ 511
            ||:...:                            ::|.:.|..|:|||:....:.|
Human   589 PESKKILTPALKKRARAGRGEATRQEESAERSEPSQHVVLSLTFKRYVFDTHKRMVQ 645

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 113/213 (53%)
SelB 6..467 CDD:225815 233/566 (41%)
SelB_II 196..278 CDD:293897 49/133 (37%)
eSelB_III 283..396 CDD:294009 43/140 (31%)
EEFSECXP_024309460.1 SelB_euk 8..209 CDD:206676 110/202 (54%)
SelB_II 224..357 CDD:293897 49/133 (37%)
eSelB_III 362..501 CDD:294009 43/140 (31%)
POLO_box <556..622 CDD:322131 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162197917
eggNOG 1 0.900 E1_COG3276
Hieranoid 1 1.000
Homologene 1 1.000 H11073
Inparanoid 1 1.050 420 1.000 Inparanoid score I1777
Isobase 1 0.950 0 Normalized mean entropy S2647
OMA 1 1.010
OrthoDB 1 1.010 D370293at33208
OrthoFinder 1 1.000 FOG0006109
OrthoInspector 1 1.000 T1075399
orthoMCL 1 0.900 OOG5_130322
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3582
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.