DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and CG4849

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_651605.1 Gene:CG4849 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster

Alignment Length:571 Identity:117/572 (20%)
Similarity:194/572 (34%) Gaps:175/572 (31%)


  Fly     2 PINFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQ-----------------SVERGITLDLG 49
            |:..|:.|:||:..||||....|  |..|     :||                 ..|||.::.. 
  Fly   129 PLIRNVALVGHLHHGKTTFVDCL--IRQT-----HPQFETMEERQLRYTDTLFTEQERGCSIKA- 185

  Fly    50 FSGLLVDAPAHLPQGEQLQFTFV----DCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAE 110
                   .|..|...:..|.:::    |.|||.:.........::.|.::|.:||.:|....|..
  Fly   186 -------TPVTLVLQDVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTER 243

  Fly   111 CLIIGELLQKKLIVVINKID------VYPENQRASKLEKLRLRLAKTLEATTFGGQVP------- 162
            .|......::.:.|.|||||      ..|......||:.:...:...|  :|:|  .|       
  Fly   244 LLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLL--STYG--APDDNLLVS 304

  Fly   163 -----ICAVSALQG-------------------THIAELREVLREAYF----------QP----Q 189
                 :|..|:|.|                   .::...:.:..:.||          ||    |
  Fly   305 PILGNVCFASSLYGFCFTLKSFAKLYADTYEGVAYLDFAKRLWGDMYFNSKTRKFSKKQPHNSAQ 369

  Fly   190 RN----LADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVT 250
            |:    :.:|::..:....|  ...|..:.||.:..|:|:.        |:.| .:|:...:.|.
  Fly   370 RSFVEFILEPMYKLIAQVVG--DVDTTLSDTLAELNVRVSK--------EEMK-SNIRPLLRLVC 423

  Fly   251 SASMGDRIG---LCVTQF-----NAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKM 307
            :..|||..|   :||...     |||.....|.|.|             |....|:::|...:..
  Fly   424 NRFMGDCSGFVDMCVEHIKSPLENAKRKVDHIYTGP-------------KEGDIYRDMISCNQYG 475

  Fly   308 HISVGHNTVMAN--VTLF----RDTDGTTSTFQ----LDKEYEYMEDVQPAEVQHNDVIYALLQF 362
            .:.|..:.:..|  .|.|    |...||....|    |.:.|...::.....:|    :..|..|
  Fly   476 TLMVHSSKMYPNDDCTFFQVLARIVSGTLHAGQEVRVLGENYTLQDEEDSRILQ----VGRLWVF 536

  Fly   363 ESPV-----LSPPHSTLIASKLDMDVHSTSC--------RLAFWGRIAWQTHS------SKYFQE 408
            ||..     ..|..:.::...:|..:..||.        .|..:..:.:.|.|      ......
  Fly   537 ESRYKVELNRVPAGNWVLIEGIDQCIVKTSTIVDINVPEDLYIFRPLKFNTQSIIKIAVEPVNPS 601

  Fly   409 ELPKLRIFKRKQKVGSIQRVVNSSEVIVQNLFKDAKRDLYVGKNVELSTGE 459
            ||||:....||         ||.|..::....:::      |::|.|.|||
  Fly   602 ELPKMLDGLRK---------VNKSYPLLSTRVEES------GEHVILGTGE 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 53/263 (20%)
SelB 6..467 CDD:225815 116/568 (20%)
SelB_II 196..278 CDD:293897 21/90 (23%)
eSelB_III 283..396 CDD:294009 23/136 (17%)
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 117/572 (20%)
Snu114p 132..340 CDD:206730 47/227 (21%)
Translation_Factor_II_like 477..568 CDD:295476 19/95 (20%)
snRNP_III 589..660 CDD:293921 16/65 (25%)
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86401712
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.