DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and waw

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001027089.1 Gene:waw FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster

Alignment Length:548 Identity:127/549 (23%)
Similarity:213/549 (39%) Gaps:141/549 (26%)


  Fly     1 MPI----NFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSV--------ERGITLDLGFSGL 53
            ||:    ||:|  :.|||.||:|||..|..::...|.:.....|        |||||:....:.:
  Fly    94 MPVERIRNFSI--IAHVDHGKSTLADRLLELTGAIARNGGQHQVLDNLQVERERGITVKAQTASI 156

  Fly    54 LVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELL 118
            .     |..:|:......:|.|||......:.......|.::|:|||..|.|.||.....:.:..
  Fly   157 F-----HRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHGVQAQTVANYHLAKQR 216

  Fly   119 QKKLIVVINKIDVYPEN--QRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAELREV 180
            |..::.|:||||:...|  |....|:.|            || ....:..|||..||.::|:.|.
  Fly   217 QLAVVPVLNKIDIKHANPDQVCQDLKLL------------FGIDPDEVLRVSAKLGTGVSEVLER 269

  Fly   181 LREAYFQPQ-RNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQM 244
            :.|....|| :..:|...:..|..|. |.:|.:....:|.||::.|..|:..|..:...||||.:
  Fly   270 VIETVPPPQVQRDSDFRALIFDSWFD-KYRGALNLIYVLNGKLEQNQDIQSLATKKVYSVKSISV 333

  Fly   245 FRK---NVTSASMGDRIGLCVTQFNAKLLERGIITQPGYLK-PIYAVCLQFKPIR--YYKEVIKS 303
            .|.   .|...|.| ::||...  |.:..:..|:....:|| ...|....::|.:  .:..|..:
  Fly   334 LRPAECPVPDVSAG-QVGLIAC--NMRNSKESIVGDTIHLKNQAVAAAGSYRPQQPLVFAGVFPA 395

  Fly   304 MRKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAEVQ----------HNDVIYA 358
            .:..|:::  .:.:..:.|    :.:..|.::|.        .||..|          |.:|...
  Fly   396 DQSKHVAL--RSAIDKMVL----NDSAVTVKIDS--------SPALGQGWRLGFLGLLHMEVFCQ 446

  Fly   359 LLQFE---SPVLSPPHST--LIAS---------KLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEE 409
            .|:.|   .|:::.|..|  |:.|         :..||:.:.:        :..:.||.|.:.|.
  Fly   447 RLEQEHGAEPIITAPSVTYRLVLSNPKMIKQQGRDTMDISNAA--------LFPEPHSIKEYYEP 503

  Fly   410 LPKLRIFKRKQKVGSIQRVVNSSEVIVQNLFKDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVA 474
            |          .:|:|   :..:|              |||:.:.|.      :||...|.|.| 
  Fly   504 L----------VLGTI---ITPTE--------------YVGQVISLC------VERRGLQQSSV- 534

  Fly   475 ITFQDALSPETISNVKNVKVLLNCKKYV 502
                         |:.:.:||:   |||
  Fly   535 -------------NIDDTRVLM---KYV 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 55/199 (28%)
SelB 6..467 CDD:225815 114/503 (23%)
SelB_II 196..278 CDD:293897 22/85 (26%)
eSelB_III 283..396 CDD:294009 21/139 (15%)
wawNP_001027089.1 PRK05433 94..695 CDD:235462 127/549 (23%)
LepA 100..277 CDD:206677 54/196 (28%)
EF4_II 285..370 CDD:293900 22/89 (25%)
EF4_III 386..461 CDD:293917 13/89 (15%)
lepA_C 502..581 CDD:239680 20/96 (21%)
LepA_C 589..695 CDD:283959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89178995
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.