DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and mEFTu2

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_610288.1 Gene:mEFTu2 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster

Alignment Length:333 Identity:91/334 (27%)
Similarity:155/334 (46%) Gaps:64/334 (19%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAA---------FDKNPQSVERGITLD---LGFSGLLVDAP 58
            |:|.:||||.|||||..|::.|.|...         .|:.|:...||||::   :|:|       
  Fly    59 NVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYS------- 116

  Fly    59 AHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQ-KKL 122
                 ..:..:...||||||..|:.:|.||..:|..:|||.|..|:..||.|.|::.:.:. :::
  Fly   117 -----TTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRI 176

  Fly   123 IVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFGG-QVPICAVSALQGTH-------IAELRE 179
            ||.|||.|:..:    ..||.:.:.:.:.|....|.| ..|:...|||....       :..:.:
  Fly   177 IVFINKADLVDQ----EVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKSEFGVPSIEK 237

  Fly   180 VLR--EAYF-QPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRK--V 239
            :|.  ::|. .|||:::.|..:.:|:.|.:.|:|||..||:.:|.:..|...:|....:..|  :
  Fly   238 LLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGTIKRGTIPRNADADLLGFNQNLKTSI 302

  Fly   240 KSIQMFRKNVTSASMGDRIGLCVTQFNAKLLERGII----------------------TQPGYLK 282
            ..||:|||:|..|..|:.:|..:.......:|||::                      .:.|.:|
  Fly   303 SDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSRAEGGRVK 367

  Fly   283 PIYAVCLQ 290
            |:.:..:|
  Fly   368 PMLSKYIQ 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 62/210 (30%)
SelB 6..467 CDD:225815 91/334 (27%)
SelB_II 196..278 CDD:293897 24/106 (23%)
eSelB_III 283..396 CDD:294009 2/9 (22%)
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 91/334 (27%)
EF_Tu 56..249 CDD:206671 59/206 (29%)
EFTU_II 257..343 CDD:293898 24/86 (28%)
mtEFTU_III 347..437 CDD:294005 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89175816
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.