DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and eEF2

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_525105.2 Gene:eEF2 FlyBaseID:FBgn0000559 Length:844 Species:Drosophila melanogaster

Alignment Length:569 Identity:117/570 (21%)
Similarity:192/570 (34%) Gaps:185/570 (32%)


  Fly     6 NIGLLGHVDSGKTTLAKALSS---------ISSTAAFDKNPQSVERGITL--------------D 47
            |:.::.|||.||:||..:|.|         ...|...|......||.||:              |
  Fly    21 NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVEEKD 85

  Fly    48 LGFSGLLVDAPAHLPQGEQ----LQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG--KQT 106
            |.|.       .|..|.|:    .....:|.|||......:....::.|..|:|||...|  .||
  Fly    86 LVFI-------THPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQT 143

  Fly   107 QTAECLIIGELLQKKLIVVINKIDVYPENQRASKLEKLRL---RLAKTLEATTFGGQVPICAVSA 168
            :|.....|.|.:  |.|:.:||:|      ||  |.:|:|   .|.:|.:.......| |.|...
  Fly   144 ETVLRQAIAERI--KPILFMNKMD------RA--LLELQLDAEELYQTFQRIVENVNV-IIATYN 197

  Fly   169 LQGTHIAELREVLREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQG-KVQVNNVIELPA 232
            ..|..:.|:|              .||            .:|:|..|:.|.| ...:....|:  
  Fly   198 DDGGPMGEVR--------------VDP------------SKGSVGFGSGLHGWAFTLKQFSEM-- 234

  Fly   233 LGEQRKVKSIQMFRKNVTSASMGDRIGLCVTQFNAKLL----------ERGIITQPGYLKPIYAV 287
            ..|:.|:..:::..:     ..|:..      ||||..          :|.....  .|.|||.|
  Fly   235 YSEKFKIDVVKLMNR-----LWGENF------FNAKTKKWQKQKEADNKRSFCMY--ILDPIYKV 286

  Fly   288 CLQFKPIRYYK--EVIKSMRKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAEV 350
               |..|..||  |:...:.|:.:::.|..        :|.||..          .::.|....:
  Fly   287 ---FDAIMNYKKEEIGTLLEKIGVTLKHED--------KDKDGKA----------LLKTVMRTWL 330

  Fly   351 QHNDVIYALLQFESPVLSPPHSTLIASKLDMDV-----HSTSCRLA------------FWGRIAW 398
            ...:.:..::....|      |.::|.|..|::     |.....:|            :..::..
  Fly   331 PAGEALLQMIAIHLP------SPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVP 389

  Fly   399 QTHSSKYFQEELPKLRIFKRKQKVGSIQRVVNSSEVIVQNLFKDAKRDLY----------VGKNV 453
            .:...:::...    |:|..|...|...|::.      .|.....|.|||          :|:.|
  Fly   390 TSDKGRFYAFG----RVFAGKVATGQKCRIMG------PNYTPGKKEDLYEKAIQRTILMMGRYV 444

  Fly   454 E-LSTGEKGRI------ERTFGQTSKVAITFQDALSPETISNVKNVKVL 495
            | :.....|.|      ::...:|..:. ||:||         .|:||:
  Fly   445 EAIEDVPSGNICGLVGVDQFLVKTGTIT-TFKDA---------HNMKVM 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 55/218 (25%)
SelB 6..467 CDD:225815 109/540 (20%)
SelB_II 196..278 CDD:293897 14/93 (15%)
eSelB_III 283..396 CDD:294009 22/132 (17%)
eEF2NP_525105.2 PTZ00416 1..844 CDD:240409 117/570 (21%)
EF2 20..236 CDD:206672 63/261 (24%)
EF2_snRNP_like_II 380..474 CDD:293901 17/105 (16%)
EF2_snRNP_III 489..560 CDD:293918
aeEF2_snRNP_like_IV 560..732 CDD:238839
eEF2_snRNP_like_C 728..807 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88285444
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.