DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and mEFG1

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_609105.1 Gene:mEFG1 FlyBaseID:FBgn0263133 Length:745 Species:Drosophila melanogaster

Alignment Length:557 Identity:110/558 (20%)
Similarity:193/558 (35%) Gaps:178/558 (32%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISST--------------AAFDKNPQSVERGITLDLGFSGLLVD 56
            |||:..|:|||||||.:.:...:..              |..|......:||||         :.
  Fly    44 NIGISAHIDSGKTTLTERILFYTGRIAEMHEVRGKDNVGATMDSMELERQRGIT---------IQ 99

  Fly    57 APAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQK- 120
            :.|.....:......:|.|||......:....:::|..:||:.|..|.|:||   |.:...::: 
  Fly   100 SAATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQT---LTVNRQMKRY 161

  Fly   121 --KLIVVINKIDVYPEN------QRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQGTHIAEL 177
              ..:..|||:|....|      |..||:......:           |:||...|..:|     :
  Fly   162 NVPCLAFINKLDRLGSNPYRVLSQMRSKMNHNAAFI-----------QLPIGVESNCKG-----I 210

  Fly   178 REVLRE--AYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVK 240
            .:::||  .||:.:..:.                                  |.|..:.:..:|:
  Fly   211 VDLVREKAIYFEGEHGMD----------------------------------IRLDEIPQDMRVE 241

  Fly   241 SIQMFRKNVTSASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIK-SM 304
            |::..::.:...|..|                         :.:..:.|:.||  :.::.|| ::
  Fly   242 SLERRQELIEHLSNAD-------------------------ETLGELFLEEKP--FTEDDIKAAL 279

  Fly   305 RKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAEVQHNDVIYALLQF------- 362
            |:..|:.....|:....|  ...|....  ||...:|:.:  |.||::       |.|       
  Fly   280 RRTCINRTFTPVLVGTAL--KNKGVQPL--LDAVLDYLPN--PGEVEN-------LGFIEKEGQD 331

  Fly   363 -ESPVLSPPHS-----TLIASKLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEELPK-LRIFK-RK 419
             |..||:|...     ..:|.||:.            ||....|: .:.:|..|.| ..||. |.
  Fly   332 PEKVVLNPARDGKDPFVGLAFKLEA------------GRFGQLTY-LRCYQGVLRKGDNIFNART 383

  Fly   420 QKVGSIQRVVNSSEVIVQNLFKDAKRDLYVGK-----NVELSTGEKGRIERTFGQTSKVAITFQD 479
            .|...|.|:|.    :..|..:|. .::|.|.     .|:.::|:      ||....|..::.:.
  Fly   384 NKKVRIARLVR----LHSNQMEDV-NEVYAGDIFALFGVDCASGD------TFTTNPKNNLSMES 437

  Fly   480 ALSPETISNV----KNVKVLLNCKKYV--FNKQAGLF 510
            ...||.:.::    .|.|...|..|.:  |.|:...|
  Fly   438 IFVPEPVVSMAIKPNNTKDRDNFSKAIARFTKEDPTF 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 48/211 (23%)
SelB 6..467 CDD:225815 99/507 (20%)
SelB_II 196..278 CDD:293897 6/82 (7%)
eSelB_III 283..396 CDD:294009 27/127 (21%)
mEFG1NP_609105.1 EF-G 44..316 CDD:206673 67/367 (18%)
PRK12740 48..727 CDD:237186 107/554 (19%)
mtEFG1_II_like 347..427 CDD:293908 24/104 (23%)
EFG_III 441..516 CDD:293919 9/35 (26%)
EFG_mtEFG1_IV 519..636 CDD:238715
mtEFG1_C 641..718 CDD:239764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88511131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.