DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and Eif2s3x

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_036140.1 Gene:Eif2s3x MGIID:1349431 Length:472 Species:Mus musculus

Alignment Length:521 Identity:118/522 (23%)
Similarity:196/522 (38%) Gaps:183/522 (35%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLV--------------- 55
            |||.:|||..||:|:.||:|.: .|..| ||  .:||.||:.||::...:               
Mouse    43 NIGTIGHVAHGKSTVVKAISGV-HTVRF-KN--ELERNITIKLGYANAKIYKLDDPSCPRPECYR 103

  Fly    56 --------DAPAHLPQGEQLQF------TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-KQ 105
                    :.|..:| |.:..|      :|||||||..|:.|::.||.::|..||::...:. .|
Mouse   104 SCGSSTPDEFPTDIP-GTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQ 167

  Fly   106 TQTAECLIIGELLQKKLIVVI-NKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSAL 169
            .||:|.|...|:::.|.|::: ||||:..|:|...:.|::   || .::.|...| .||..:||.
Mouse   168 PQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQI---LA-FVQGTVAEG-APIIPISAQ 227

  Fly   170 QGTHIAELREVLREAYFQPQRNLADPLFMYVDHCFGIKG--------QGTVCTGTLLQGKVQVNN 226
            ...:|..:.|.:.:....|.|:......:.|...|.:..        :|.|..|::|:|.::|..
Mouse   228 LKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQ 292

  Fly   227 VIELPALGEQRKVKSIQMFRKNVTSASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQF 291
            .||:                          |.|:.......||:          .|||::..   
Mouse   293 EIEV--------------------------RPGIVSKDSEGKLM----------CKPIFSKI--- 318

  Fly   292 KPIRYYKEVIKSMRKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAEVQHNDVI 356
                                        |:||                          .:|||:.
Mouse   319 ----------------------------VSLF--------------------------AEHNDLQ 329

  Fly   357 YALLQFESPVLSPPHSTLIASKLDMDVHSTSCR--------LAFWG---RIAWQTHSSKYFQEEL 410
            ||         :|.....:.:|:|    .|.||        |...|   .|..:...|.:....|
Mouse   330 YA---------APGGLIGVGTKID----PTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRL 381

  Fly   411 PKLRIFKRKQKVGSIQRVVNSSEVIVQNLFKDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAI 475
            ..:|. :..:|...:|: ::.:||::.|          :|   .||||  ||:........|:.:
Mouse   382 LGVRT-EGDKKAAKVQK-LSKNEVLMVN----------IG---SLSTG--GRVSAVKADLGKIVL 429

  Fly   476 T 476
            |
Mouse   430 T 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 67/217 (31%)
SelB 6..467 CDD:225815 116/511 (23%)
SelB_II 196..278 CDD:293897 14/90 (16%)
eSelB_III 283..396 CDD:294009 18/124 (15%)
Eif2s3xNP_036140.1 PTZ00327 13..466 CDD:240362 118/522 (23%)
eIF2_gamma 42..248 CDD:206675 66/215 (31%)
G1. {ECO:0000255|PROSITE-ProRule:PRU01059} 48..55 5/7 (71%)
G2. {ECO:0000255|PROSITE-ProRule:PRU01059} 76..80 2/4 (50%)
G3. {ECO:0000255|PROSITE-ProRule:PRU01059} 134..137 3/3 (100%)
G4. {ECO:0000255|PROSITE-ProRule:PRU01059} 190..193 3/3 (100%)
G5. {ECO:0000255|PROSITE-ProRule:PRU01059} 225..227 2/2 (100%)
eIF2_gamma_II 249..362 CDD:293889 32/219 (15%)
eIF2_gamma_III 365..459 CDD:294011 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3276
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.