DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and tuf1

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_595746.1 Gene:tuf1 PomBaseID:SPBC9B6.04c Length:439 Species:Schizosaccharomyces pombe

Alignment Length:379 Identity:113/380 (30%)
Similarity:170/380 (45%) Gaps:75/380 (20%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISS---TAAF------DKNPQSVERGITLDLGFSGLLVDAPAHL 61
            |||.:||||.|||||..|::...|   .|:|      ||.|:...||||:          :.||:
pombe    55 NIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITI----------SSAHV 109

  Fly    62 P-QGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIG-ELLQKKLIV 124
            . :.....:..|||||||..|:.:|.||..:|..::||.|..|:..||.|.|::. ::..|:::|
pombe   110 EYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVV 174

  Fly   125 VINKID-VYPENQRASKLEKLRLRLAKTLEATTF-GGQVPI---CAVSALQG-------THIAEL 177
            .|||:| |.|:     .:|.:.:.:.:.|....| |...||   .|:.||:|       ..|.:|
pombe   175 YINKVDMVEPD-----MIELVEMEMRELLSEYGFDGDNTPIVSGSALCALEGREPEIGLNSITKL 234

  Fly   178 REVLREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRK--VK 240
            .|.:......|:|....|..|.::..|.|.|:|||.||.:.:|.::....||:...|...|  |.
pombe   235 MEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSHLKTTVT 299

  Fly   241 SIQMFRKNVTSASMGDRIGLCVTQFNAKLLERG-IITQPGYLKPIYAVCLQFKPIRYYKEVIKSM 304
            .|:||:|.:.:|..||..||.:.....:.|:|| |:.|||.:.|                     
pombe   300 GIEMFKKQLDAAVAGDNCGLLLRSIKREQLKRGMIVAQPGTVAP--------------------- 343

  Fly   305 RKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKE----YEYMEDVQPAEVQHND 354
                    |....|:..:....:|...|..:||.    |....|| ..|:.|.|
pombe   344 --------HQKFKASFYILTKEEGGRRTGFVDKYRPQLYSRTSDV-TVELTHPD 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 68/209 (33%)
SelB 6..467 CDD:225815 113/380 (30%)
SelB_II 196..278 CDD:293897 29/85 (34%)
eSelB_III 283..396 CDD:294009 13/77 (17%)
tuf1NP_595746.1 PRK00049 42..439 CDD:234596 113/380 (30%)
EF_Tu 52..245 CDD:206671 66/205 (32%)
EFTU_II 253..339 CDD:293898 30/86 (35%)
EFTU_III 343..434 CDD:294006 13/77 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.