DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and efsc-1

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_493275.1 Gene:efsc-1 WormBaseID:WBGene00008133 Length:500 Species:Caenorhabditis elegans

Alignment Length:518 Identity:159/519 (31%)
Similarity:263/519 (51%) Gaps:66/519 (13%)


  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVE----RGITLDLGFSGLLVDAPAHLPQGEQ 66
            |:|:|||||||||||.:.::.:.||:|||.:..|..    |..|||||||.:.      ...|.:
 Worm    15 NLGILGHVDSGKTTLTRRIAELGSTSAFDAHATSTTTDGIRRNTLDLGFSTMT------SLSGRR 73

  Fly    67 LQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLII-GELLQKKLIVVINKID 130
            |  ..:|||||:.|||.::..:.:.|:.::::|...|.|.||||.|:: .:....::|:|:||.|
 Worm    74 L--ALIDCPGHSGLIRAVLAASTVFDMAIVIIDVVAGIQPQTAEHLLLASKFCPNRVIIVLNKCD 136

  Fly   131 VYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSALQGTHIAELREVLREA----YFQPQRN 191
            :..:::.:...:|:|    |.|::.......||..:|...|....|:.:.|:.|    .|:|:|:
 Worm   137 LAEKSKISESAKKVR----KGLKSMGVDENSPIVEMSLADGYFKEEMLQNLKLAIESRIFEPKRD 197

  Fly   192 LADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVTSASMGD 256
            ......:.:||||.|||||||.|||:::|.:::|..||.|||.|:|:||:::.:::.|...:.|.
 Worm   198 EEGEFLIAIDHCFAIKGQGTVLTGTVIRGVLRLNTEIEFPALNEKRRVKTLETWKQRVGQVAAGA 262

  Fly   257 RIGLCVT-QFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHNTVMANV 320
            |....|. .|:.....|.|....|.||....|....:||:::::.|.|..|:|::|...||||..
 Worm   263 RAAFLVAPSFDEHRFSRCICGPLGTLKSTKFVLATVEPIQFFRKSINSKSKIHVAVAFETVMAEC 327

  Fly   321 TLFRDTDGTTSTFQLDKEYEYMED-VQPAEVQHNDVIYALLQFESPVLSPPH--STLIASKLDMD 382
            ...::.:        :.|:|.:.. :.|.:|        |..||..:..|.:  :..:|::|:..
 Worm   328 QFLKEKE--------NGEFEMLPSLLAPCQV--------LFSFEKSIFLPENYSNPFMAARLEQQ 376

  Fly   383 VHSTSCRLAFWGRIAWQTHSSKYFQEELPK-----LRIFKRKQKVGSIQRVVNSS-EVIVQNLFK 441
            ..| .||.||.|          .|.:.||:     ...|.||.:.|.::||.... ..|...:||
 Worm   377 PGS-GCRFAFSG----------IFSQILPENGKNLPPRFTRKCRKGHVERVEKDGFSAICTGMFK 430

  Fly   442 -DAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAITFQDALSPETISNVKNVK--VLLNCKKY 501
             :...|::.|..:..|:|.:|:||..||::.|..:||     .|.|..:...|  :.|..|||
 Worm   431 AETNFDVFRGFQICTSSGPRGKIEGAFGKSGKFRVTF-----AEKIDGILTEKEEISLFLKKY 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 65/195 (33%)
SelB 6..467 CDD:225815 147/481 (31%)
SelB_II 196..278 CDD:293897 32/83 (39%)
eSelB_III 283..396 CDD:294009 28/116 (24%)
efsc-1NP_493275.1 SelB 14..493 CDD:225815 159/519 (31%)
P-loop_NTPase 15..189 CDD:304359 62/186 (33%)
SelB_II 202..282 CDD:293897 32/80 (40%)
eSelB_III 294..387 CDD:294009 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162187711
eggNOG 1 0.900 E1_COG3276
Hieranoid 1 1.000
Homologene 1 1.000 H11073
Inparanoid 1 1.050 216 1.000 Inparanoid score I2295
Isobase 1 0.950 0 Normalized mean entropy S2647
OMA 1 1.010
OrthoDB 1 1.010 D370293at33208
OrthoFinder 1 1.000 FOG0006109
OrthoInspector 1 1.000 T475817
orthoMCL 1 0.900 OOG5_130322
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3582
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.