DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and tufm-2

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_491338.2 Gene:tufm-2 WormBaseID:WBGene00007001 Length:439 Species:Caenorhabditis elegans

Alignment Length:438 Identity:113/439 (26%)
Similarity:191/439 (44%) Gaps:72/439 (16%)


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSISSTAAF---------DKNPQSVERGITLDLGFSGLLVDAP 58
            ||.|:|.:||:|.|||||..|::.:.:...|         ||..:..:||||:::          
 Worm    44 INVNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINV---------- 98

  Fly    59 AHLPQGEQL-QFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELL-QKK 121
            ||:.....| :::..|||||:..|:.:|.|...:|:.:||:.|..|...||.|.||:.:.: .|.
 Worm    99 AHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVMEQTKEHLILAKQVGVKN 163

  Fly   122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQ-VPI---CAVSALQGTHIAELREVL- 181
            :.:.|||.|:..|:.    |:.:.:...:.|....|.|. .|:   .|:|||:|..|:.:..:: 
 Worm   164 MAIFINKADLVEEDD----LDLVEMEARELLSLHGFNGDATPVIRGSALSALEGQDISCIERLID 224

  Fly   182 -REAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGE--QRKVKSIQ 243
             .::..:|.||..|...|.:.....|.|:|||..|||.:|.::..:.:|:...|:  |.....||
 Worm   225 ALDSLPEPDRNEKDTFVMPIASKTAITGRGTVIVGTLERGVLKKGDKVEIKGDGQTLQTTASDIQ 289

  Fly   244 MFRKNVTSASMGDRIGLCVTQFNAKLLERGI-ITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKM 307
            :|.|:|.....||..|:.........::||: ...||.:    .:..:.|...|.....::.||:
 Worm   290 VFGKSVKEVRAGDHCGVLCRGVKGDTVKRGMWAGHPGAV----TITNRVKVELYLLSEAENGRKI 350

  Fly   308 HISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAEVQHNDVIYALLQFESPVLSPPHS 372
            .|..|....|     :..|......|.:..|.     :.|.|  |.... .||..:.|:......
 Worm   351 GIRTGFTDKM-----YCSTWDQVGRFDMSNEL-----LMPGE--HTSAT-VLLMKDMPLRKGMPF 402

  Fly   373 TL--------IASKL--DMDVHSTSCRLAFWGRIAWQTHSSKYFQEEL 410
            ||        ||..:  |::.|           :|.:.|:.|...|::
 Worm   403 TLREGSSKTTIARGIISDLEDH-----------VAVEKHNLKKSAEKM 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 59/204 (29%)
SelB 6..467 CDD:225815 111/436 (25%)
SelB_II 196..278 CDD:293897 23/85 (27%)
eSelB_III 283..396 CDD:294009 22/123 (18%)
tufm-2NP_491338.2 PRK12736 43..423 CDD:237184 108/410 (26%)
EF_Tu 44..232 CDD:206671 58/202 (29%)
EFTU_II 240..326 CDD:293898 24/86 (28%)
mtEFTU_III 329..421 CDD:294005 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.