DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and HBS1

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001286906.1 Gene:HBS1 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster

Alignment Length:407 Identity:97/408 (24%)
Similarity:168/408 (41%) Gaps:69/408 (17%)


  Fly     9 LLGHVDSGKTTL----------------------AKALSSISSTAAF--DKNPQSVERGITLDLG 49
            ::||||:||:||                      :|.|...|...|:  |:..:...||||:|:|
  Fly   252 VIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETGEERARGITMDVG 316

  Fly    50 FSGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGK-------QTQ 107
            .|.:         :.:....|.:|.|||...|..:|.||...|:.||||||.:|:       ..|
  Fly   317 QSRI---------ETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQ 372

  Fly   108 TAE-CLIIGELLQKKLIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTF-GGQVPICAVSALQ 170
            |.| .:::..|...:|.|||||:|....:|  .:..::..:|...|:...| ...|.....|.|.
  Fly   373 TREHAILVRSLGVNQLGVVINKLDTVGWSQ--DRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLT 435

  Fly   171 GTHIAE---------------LREVLREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQG 220
            |.::.:               |.:|: |.:..|:|.:..||.|.|...:...|.|...:|.:..|
  Fly   436 GENLTKKAQEPALTNWYSGRHLLDVI-ENFKIPERAIDRPLRMSVSDIYKGTGSGFCISGRVETG 499

  Fly   221 KVQVNNVIELPALGEQRKVKSIQMFRKNVTSASMGDRIGLCVTQFNAKLLERG-IITQPGYLKPI 284
            .:.:|:.:.:.|..||.:|||:.|.....|....||::.:.:...:...:..| ||:.|....|:
  Fly   500 VLCLNDKVLVGASREQAQVKSLTMNEFPQTCVFAGDQVSVTLPALDINNVTVGCIISDPQTPIPV 564

  Fly   285 YAVCLQFKPIRYYKEVIKSMRKMHISVGHNTVMANVTLFRDTDGTTSTFQLDKEYEYMEDVQPAE 349
                    ..|:...:|....|:.|::|...::.:.:|.........|..:.|....:...:|..
  Fly   565 --------TTRFQARIIVFNVKVPITMGFPVLLHHQSLIEPAVVCKLTASIHKSTGEVVKKKPRC 621

  Fly   350 VQHNDVIYALLQFESPV 366
            :.:|......|:...|:
  Fly   622 LGNNSCALVELETSRPI 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 61/231 (26%)
SelB 6..467 CDD:225815 97/408 (24%)
SelB_II 196..278 CDD:293897 21/83 (25%)
eSelB_III 283..396 CDD:294009 13/85 (15%)
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079
TEF1 241..669 CDD:227581 97/408 (24%)
EF1_alpha 249..468 CDD:206670 60/228 (26%)
HBS1-like_II 474..557 CDD:293912 22/83 (27%)
HBS1_C_III 561..669 CDD:294008 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88630532
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.