DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eEFSec and eefsec

Sequence 1:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_002933127.2 Gene:eefsec XenbaseID:XB-GENE-1010963 Length:576 Species:Xenopus tropicalis

Alignment Length:569 Identity:258/570 (45%)
Similarity:349/570 (61%) Gaps:61/570 (11%)


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSISSTAAFDKNPQSVERGITLDLGFSGLLVDAPAHLPQG--E 65
            :|||:|:|||:|||||:||||||:.:|||||||||||.|||||||||||...|..|.||...  :
 Frog     8 LNFNVGVLGHIDSGKTSLAKALSTTASTAAFDKNPQSKERGITLDLGFSSFSVPIPEHLAGTGYQ 72

  Fly    66 QLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQKKLIVVINKID 130
            :||||.|||||||||||||||||||||||:||:|..||.|||:||||:||::...|::||:||||
 Frog    73 RLQFTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIGQIACNKMVVVLNKID 137

  Fly   131 VYPENQRASKLEKLRLRLAKTLEATTFGGQVPICAVSA----------LQGTHIAELREVLREAY 185
            :..||:|.:.::|:..::.||||.|.|.|. ||.:|:|          :.|..:::|.|:|....
 Frog   138 LLAENKRQAAIDKMTKKMQKTLENTKFHGS-PIISVAAKPGGPEAPESVTGLGVSDLIELLMSHT 201

  Fly   186 FQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVT 250
            :.|||:...|..|.|||||.|||||||.|||:|.|.:.:|:.:|:|||...:||||:|||.|.|:
 Frog   202 YLPQRDPQGPFLMAVDHCFSIKGQGTVMTGTILSGSISLNDNVEIPALKVTKKVKSMQMFHKPVS 266

  Fly   251 SASMGDRIGLCVTQFNAKLLERGIITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHNT 315
            .|..|||:|:|||||:.||||||::..|..|..|:|..:....|.|||..:::..|.||:|.|.|
 Frog   267 QAVQGDRLGICVTQFDPKLLERGLVCTPESLHTIHAAIISVNKIPYYKGSLQTKAKFHITVSHET 331

  Fly   316 VMANVTLFR------DTDGTTSTFQLDKEYEYME-----DVQPAEV------QHNDVI----YAL 359
            |||.||.|.      :.:...:.|...|||.|.:     |.:.:|.      |..:.|    :||
 Frog   332 VMAKVTFFSLPPASFNEELPANVFDFGKEYLYQDGYISKDSKNSEQNKVDNHQGEEAIPKQQWAL 396

  Fly   360 LQFESPVLSPPHSTLIASKLDMDVHSTSCRLAFWGRIAWQTHSSKYFQEELPKLRIFKRKQKVGS 424
            |:||.||..|....:|.||||.|:||.:|||||.|.:........|.:..||.|:::|.|.|.|.
 Frog   397 LEFEKPVTCPKLCLVIGSKLDTDIHSNTCRLAFHGVLIEGVEDKNYSESFLPNLKVYKLKHKEGQ 461

  Fly   425 IQRVVNSSEVIVQNLF-KDAKRDLYVGKNVELSTGEKGRIERTFGQTSKVAITFQDALSPE---- 484
            ::||.:...:|.::|| |:....|:||..|:|||||.|.||.:|||:.|..|...:.|.||    
 Frog   462 VERVNDDYSIIGRSLFKKETNIQLFVGLKVKLSTGEDGVIEGSFGQSGKFKIRIPNGLQPETKKM 526

  Fly   485 -TISNVKNVK---------------------VLLNCKKYVFNKQAGLFQ 511
             |.|:.|.:|                     :.|..|:|:|:.|..:.|
 Frog   527 LTASSKKRLKGKGDADPAKEEEVRQDNQPILITLWFKRYMFDPQKKMIQ 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 113/199 (57%)
SelB 6..467 CDD:225815 238/495 (48%)
SelB_II 196..278 CDD:293897 48/82 (59%)
eSelB_III 283..396 CDD:294009 49/134 (37%)
eefsecXP_002933127.2 SelB_euk 10..201 CDD:206676 110/192 (57%)
GTP_EFTU 11..200 CDD:278438 109/190 (57%)
SelB_II 212..294 CDD:293897 48/82 (59%)
eSelB_III 299..433 CDD:294009 49/134 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162196891
eggNOG 1 0.900 E1_COG3276
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11073
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D370293at33208
OrthoFinder 1 1.000 FOG0006109
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.