DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and AT1G01310

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana

Alignment Length:127 Identity:31/128 (24%)
Similarity:47/128 (37%) Gaps:24/128 (19%)


  Fly    97 WDEEL----EYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWD-LNVTNLVEQSMGLW 156
            ||..|    ...|...:..|.|.|.  :..|     |:|:.... :.||. .::.|       :|
plant   106 WDGRLAAYARTWANQRVGDCRLVHS--NGPY-----GENIFWAG-KNNWSPRDIVN-------VW 155

  Fly   157 FGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY 218
            ..|.|..|....|    .:.....||:.:.|...:|.||||.:..:|.....:.:||...||
plant   156 ADEDKFYDVKGNT----CEPQHMCGHYTQIVWRDSTKVGCASVDCSNGGVYAICVYNPPGNY 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 31/128 (24%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10334
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.