DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and AT4G30320

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana

Alignment Length:174 Identity:37/175 (21%)
Similarity:60/175 (34%) Gaps:48/175 (27%)


  Fly    50 SCSPDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEEL----EYLATLNLK 110
            :|...||      |::..:...|..|.::            |:..:.||.:|    ::.|.....
plant    19 TCCHCAT------YQEQFMGPQNAARAHL------------RLKPLKWDAKLARYAQWWANQRRG 65

  Fly   111 TCYLEHDDCHNSYRFRNLGQNLCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTK 175
            .|.|.|.  :..|     |:||......| |.      ..|:...|..|.:    ||  :::...
plant    66 DCALTHS--NGPY-----GENLFWGSGNR-WG------PSQAAYGWLSEAR----SY--NYRSNS 110

  Fly   176 -DLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTACNY 218
             :.|..||:.:.|......:|||.:........||     .|||
plant   111 CNSEMCGHYTQIVWKNTQKIGCAHVICNGGGGVFL-----TCNY 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 33/161 (20%)
AT4G30320NP_194761.1 SCP_PR-1_like 27..161 CDD:240181 33/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10334
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.