DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9822 and Crisp3

DIOPT Version :9

Sequence 1:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:57/258 - (22%)
Similarity:94/258 - (36%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNK-RR 75
            :|::|.:|:..|     |.|..|.|     :...:..|:.|.....|     ::.|:|:||: ||
  Rat     4 MLVLLFLAAVLP-----PSLLQDTT-----DEWDRDLENLSTTKLSV-----QEEIINKHNQLRR 53

  Fly    76 NYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRN 140
            ....|||        .:..:.||.:....|......|...|....:.......|:||...:...:
  Rat    54 TVSPSGS--------DLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENLFMANYPAS 110

  Fly   141 WDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQ 205
            |...:.:..::|:...||            |...|...|.||:.:.|.:....|.|.:...  |.
  Rat   111 WSSVIQDWYDESLDFVFG------------FGPKKVGVKVGHYTQVVWNSTFLVACGVAEC--PD 161

  Fly   206 YPFLYIYNTACNY-------ASVYAIGVPVYNAGKPASECRTGSNPEYPALCSIKEQYNPNHN 261
            .|..|.|  .|:|       ..:|:    .|..|:|...|  ..|.| ..||:...:|..|::
  Rat   162 QPLKYFY--VCHYCPGGNYVGRLYS----PYTEGEPCDSC--PGNCE-DGLCTNSCEYEDNYS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 35/162 (22%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 36/163 (22%)
Crisp 192..246 CDD:285731 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344815
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.