DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and Crisp3

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 RGDID:619846 Length:246 Species:Rattus norvegicus

Alignment Length:258 Identity:57/259 (22%)
Similarity:94/259 (36%) Gaps:54/259 (21%)


  Fly    12 LLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNK-RR 75
            :|::|.:|:..|     |.|..|.|     :...:..|:.|.....|     ::.|:|:||: ||
  Rat     4 MLVLLFLAAVLP-----PSLLQDTT-----DEWDRDLENLSTTKLSV-----QEEIINKHNQLRR 53

  Fly    76 NYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVDRRRN 140
            ....|||        .:..:.||.:....|......|...|....:.......|:||...:...:
  Rat    54 TVSPSGS--------DLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENLFMANYPAS 110

  Fly   141 WDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQ 205
            |...:.:..::|:...||            |...|...|.||:.:.|.:....|.|.:...  |.
  Rat   111 WSSVIQDWYDESLDFVFG------------FGPKKVGVKVGHYTQVVWNSTFLVACGVAEC--PD 161

  Fly   206 YPFLYIYNTACNY-------ASVYAIGVPVYNAGKPASECRTGSNPEYPALCSIKEQYNPNHN 261
            .|..|.|  .|:|       ..:|:    .|..|:|...|  ..|.| ..||:...:|..|::
  Rat   162 QPLKYFY--VCHYCPGGNYVGRLYS----PYTEGEPCDSC--PGNCE-DGLCTNSCEYEDNYS 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 35/163 (21%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 36/164 (22%)
Crisp 192..246 CDD:285731 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C89158915
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10334
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.