DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and pi15b

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio

Alignment Length:198 Identity:55/199 (28%)
Similarity:76/199 (38%) Gaps:39/199 (20%)


  Fly    67 IVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN 131
            |::.|||.|..:       :.||..|..|:||:.|...|.....||..||..   .|..|.||||
Zfish    69 ILDYHNKVRANV-------FPPAANMEYMLWDDGLARSAEAWAATCIWEHGP---PYLLRYLGQN 123

  Fly   132 LCGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYG----HFVETVLDRNT 192
            |.  .|..|: .::..||:.    |:.|.:.....|..|......:..||    |:.:.|...:.
Zfish   124 LS--VRTGNY-RSILQLVKP----WYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSN 181

  Fly   193 HVGCAMMRFTNPQYPFLYIYNT--------ACNYA-SVYAIGVPVYNAGKPASECRTGSNPEYPA 248
            .||||:....|     :.::..        .|||: ....||...|..|.|.|.|    .|.|..
Zfish   182 RVGCAIQTCFN-----MVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSAC----PPSYGG 237

  Fly   249 LCS 251
            .||
Zfish   238 SCS 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 44/164 (27%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.