DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and scpr-C

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001287282.1 Gene:scpr-C FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster

Alignment Length:254 Identity:89/255 (35%)
Similarity:126/255 (49%) Gaps:19/255 (7%)


  Fly    12 LLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNEHNKRRN 76
            |..:||:  |....:|....|.|.  ||||||.|.|.|:|..|...|.::|:.|||:|..|:.||
  Fly     9 LTSLLGI--SLAADYCALPTCLDK--HIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRN 69

  Fly    77 YIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQN-----LCGVD 136
            .:|.|.:.|...|.|||.|.|.|||.:||.||:|||....|.|.::.||...|||     ..|.:
  Fly    70 NVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAE 134

  Fly   137 RRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRF 201
            .    :.....::::.:..||.|........:..|......:....|...|.::|||||||.:||
  Fly   135 T----EYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF 195

  Fly   202 TNPQYPFLYIYNTACNYASVYAIGVPVYNAGKPASE-C--RTGSNPEYPALCSIKEQYN 257
            :...|....:   .||:|:...:|.|||..|:.|:. |  |.|:..:||.||..||.|:
  Fly   196 SRDFYNHFVL---TCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 52/160 (33%)
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 52/159 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C583767
eggNOG 1 0.900 E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3854
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 1 1.000 FOG0000586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10334
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.