DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and CG30486

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster

Alignment Length:254 Identity:81/255 (32%)
Similarity:124/255 (49%) Gaps:12/255 (5%)


  Fly    13 LIILGMASSQPLS--WCDPDLCPDNTVHIACNNDGKFHESCSPDATM----VDLKPYRKLIVNEH 71
            ::|:.:.|.:.||  :|:.|||.....||||.|.|.|.|||..:|.:    :.::.:...::|:.
  Fly     7 VLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDF 71

  Fly    72 NKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHDDCHNSYRFRNLGQNLCGVD 136
               ||.:|.|..|...||:||||:.|.|||..||...|:.|....|.|.|:..|..:.. :.|..
  Fly    72 ---RNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSY-IYGST 132

  Fly   137 RRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRF 201
            :....:.:..::::..:..|..:.|....::|...|..||.:..|:|.:.|.|...||||||| .
  Fly   133 KWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMM-L 196

  Fly   202 TNPQYPFLYIYNTACNYASVYAIGVPVYNA-GKPASECRTGSNPEYPALCSIKEQYNPN 259
            ...|...||.|...|:::........||.| ..|.|.|..|::..|..|||.:|..|||
  Fly   197 RKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPN 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 47/155 (30%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C582037
eggNOG 1 0.900 E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3854
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 1 1.000 FOG0000586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10334
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.