DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and GLIPR1

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 HGNCID:17001 Length:266 Species:Homo sapiens

Alignment Length:196 Identity:51/197 (26%)
Similarity:77/197 (39%) Gaps:36/197 (18%)


  Fly    53 PDATMVDLKPYRKLIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD 117
            ||   ::.:.:.|..|..|||.|:.:..       .|:.|..|.||..|..:|......|...|:
Human    26 PD---IENEDFIKDCVRIHNKFRSEVKP-------TASDMLYMTWDPALAQIAKAWASNCQFSHN 80

  Fly   118 ----DCHNSY-RFRNLGQNLCGVDRRRNWDLNVTNL-VEQSMGLWFGEHKLIDSSYITDFKLTKD 176
                ..|..: .|.:||:|:        |..:|... |..::..|:.|.:    .|  ||| |:.
Human    81 TRLKPPHKLHPNFTSLGENI--------WTGSVPIFSVSSAITNWYDEIQ----DY--DFK-TRI 130

  Fly   177 LEKY-GHFVETVLDRNTHVGCAMMRFTNPQYPFLYIYNTA---CNYASVYAIGVPVYNAGKPASE 237
            .:|. ||:.:.|...:..|||| ::|......|..:.|.|   |||..........|..|...|.
Human   131 CKKVCGHYTQVVWADSYKVGCA-VQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSA 194

  Fly   238 C 238
            |
Human   195 C 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 45/165 (27%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.