| Sequence 1: | NP_611581.1 | Gene: | CG9822 / 37440 | FlyBaseID: | FBgn0034623 | Length: | 263 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017210734.1 | Gene: | glipr1a / 108179203 | ZFINID: | ZDB-GENE-110309-2 | Length: | 269 | Species: | Danio rerio | 
| Alignment Length: | 273 | Identity: | 65/273 - (23%) | 
|---|---|---|---|
| Similarity: | 98/273 - (35%) | Gaps: | 76/273 - (27%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     6 FQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNE 70 
  Fly    71 HNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD-DCHNSYR----FRNLGQ 130 
  Fly   131 NL-CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHV 194 
  Fly   195 GCAMM---------RFTNPQ-YPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPAL 249 
  Fly   250 C-----SIKEQYN 257 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG9822 | NP_611581.1 | SCP_euk | 64..219 | CDD:240180 | 42/170 (25%) | 
| glipr1a | XP_017210734.1 | None | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5251 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.970 | |||||