DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9822 and glipr1a

Sequence 1:NP_611581.1 Gene:CG9822 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio

Alignment Length:273 Identity:65/274 (24%)
Similarity:98/274 (36%) Gaps:76/274 (28%)


  Fly     6 FQTVGCLLIILGMASSQPLSWCDPDLCPDNTVHIACNNDGKFHESCSPDATMVDLKPYRKLIVNE 70
            ||.:.....:||:.||:.|.    |:           .|..|.:.|                |.|
Zfish     5 FQLLISACFLLGVFSSEYLF----DI-----------TDRAFIDEC----------------VRE 38

  Fly    71 HNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEHD-DCHNSYR----FRNLGQ 130
            ||:.|:.::.       .|..|..|.||..|...|....:.|..:|: ....:.|    |..:|:
Zfish    39 HNQNRSSVSP-------TAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGE 96

  Fly   131 NL-CGVDRRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDFKLTKDLEKYGHFVETVLDRNTHV 194
            |: .|....|       ..|:.::..|..|.|  |.:|  :.....|.:..||:.:.|...:..|
Zfish    97 NIWAGAPYSR-------FTVKSAVFSWVNELK--DYNY--NNNQCNDKKVCGHYTQVVWADSYKV 150

  Fly   195 GCAMM---------RFTNPQ-YPFLYIYNTACNYASVYAIGVPVYNAGKPASECRTGSNPEYPAL 249
            |||:.         .|:|.| ..|:..|.||.|:|     |...|..|...|.| .||:.....|
Zfish   151 GCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFA-----GRSPYKQGASCSGC-GGSDKCERNL 209

  Fly   250 C-----SIKEQYN 257
            |     ..::.||
Zfish   210 CRNTDRDAEQSYN 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 42/171 (25%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.